Tesamorelin 5 mg
Kalpa Pharmaceuticals

Tesamorelin 5 mg

Product Details Kalpa Pharmaceuticals
Active Substance Tesamorelin GHRH / GHRF analogue
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes
Primary Target GHRH receptor Stimulates endogenous GH release
Shipping Location :
International
U.S. Domestic
Out of stock

Kalpa Pharmaceuticals Tesamorelin 5 mg – Potent GHRH Analog

βœ” High-purity lyophilized powder βœ” 5 mg per 2 mL vial βœ” Potent GHRH (1-44) analog βœ” USA & International shipping

Kalpa Pharmaceuticals Tesamorelin 5 mg is a synthetic analog of growth hormone-releasing hormone (GHRH), specifically the full-length GHRH (1-44) sequence with a chemical modification that enhances its resistance to enzymatic degradation. Each 2 mL vial contains 5 mg of lyophilized Tesamorelin, designed for reconstitution in research settings investigating metabolic function, body composition, and growth hormone regulation.

Tesamorelin acts on the pituitary somatotrophs to stimulate endogenous growth hormone release with greater potency and duration than shorter GHRH analogs. For researchers studying visceral adiposity and metabolic parameters, this peptide offers distinct advantages. Explore similar research compounds like Sermorelin 5 mg or Ipamorelin 5 mg.

What Makes Kalpa Pharmaceuticals Tesamorelin Unique?

Tesamorelin contains a trans-3-hexenoic acid modification at the N-terminus, which confers resistance to dipeptidyl peptidase-4 (DPP-4) degradation, resulting in a longer half-life compared to unmodified GHRH (1-44). This modification allows for once-daily administration in research protocols while maintaining biological activity.

For metabolic research, Tesamorelin has been extensively studied for its effects on visceral adipose tissue and metabolic parameters. The 5 mg dosage provides sufficient material for extended research protocols investigating chronic GHRH analog administration. Researchers may also compare Tesamorelin with Sermorelin to evaluate differences between GHRH fragments and full-length analogs.

Benefits of Kalpa Pharmaceuticals Tesamorelin for Research

  • βœ” Full-length GHRH (1-44) analog with enhanced stability
  • βœ” DPP-4 resistant for extended duration of action
  • βœ” 5 mg lyophilized powder for reconstitution flexibility
  • βœ” Suitable for subcutaneous administration research
  • βœ” Relevant for metabolic and body composition studies
Research Grade

Kalpa Pharmaceuticals Tesamorelin 5 mg is intended for laboratory research only. Not for human consumption or clinical use.

External research on Tesamorelin's mechanisms can be explored via PubMed for peer-reviewed studies.

Technical Details

Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Parent Peptide
Human Growth Hormone-Releasing Hormone (GHRH)
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
CAS Number
218949-48-5
PubChem CID
16137828
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis

Dosage & Usage Guidelines for Research

For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.

Reconstitution Protocol

  • βœ” Add 2-3 mL bacteriostatic water to the 5 mg vial
  • βœ” Swirl gently; do not shake
  • βœ” Store reconstituted peptide at 2-8°C and use within 30 days

The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL (1670-2500 mcg/mL). For precise dosing, researchers should calculate based on desired mg per injection volume.

Typical Research Parameters

In animal models, Tesamorelin is often administered at dosages ranging from 1-2 mg per day. Due to its approximately 2-hour half-life, once-daily administration is typical in prolonged studies. Subcutaneous injection is the standard route for systemic absorption research.

  • βœ” Subcutaneous injection: 1-2 mg once daily
  • βœ” Research models: Dosing typically scaled by body weight
  • βœ” Study duration: 4-12 weeks for metabolic and body composition studies

Combination Research

Tesamorelin is often studied in isolation for its effects on GH release and metabolic parameters. However, some protocols combine it with GHRP compounds to evaluate synergistic effects on GH pulsatility. For comprehensive metabolic research, explore our range of MOTS-c 10 mg.

Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.

What to Avoid During Research

  • ❌ Do not use if the lyophilized cake appears discolored or collapsed
  • ❌ Avoid exposure to high heat or direct light
  • ❌ Do not mix with strong solvents or extreme pH solutions
  • ❌ Avoid repeated freeze-thaw cycles after reconstitution

Shipping & Product Authenticity

USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Kalpa Pharmaceuticals distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Kalpa Pharmaceuticals presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage Guidelines for Lyophilized Peptides

Store Kalpa Pharmaceuticals Tesamorelin 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.

After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.

Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.

Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Kalpa Pharmaceuticals Tesamorelin 5 mg used for in research?

Tesamorelin is studied as a potent GHRH analog that stimulates endogenous growth hormone release. Research applications include metabolic studies, visceral adiposity investigations, and body composition research in animal models.

How is Kalpa Pharmaceuticals Tesamorelin typically reconstituted?

Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.

What is the typical research dosage for Tesamorelin?

In animal studies, dosages often range from 1-2 mg per day, administered once daily due to the approximately 2-hour half-life. Dosing should be scaled appropriately for the research model and study objectives.

How is Tesamorelin different from Sermorelin?

Tesamorelin is a full-length GHRH (1-44) analog with a chemical modification that confers DPP-4 resistance and a longer half-life. Sermorelin is a shorter GHRH (1-29) fragment without this modification, resulting in different pharmacokinetic properties.

Is Kalpa Pharmaceuticals Tesamorelin tested for purity?

Third-party COA testing is currently pending. Kalpa Pharmaceuticals is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.

No reviews found

Please log in to write Tesamorelin 5 mg review.

Related Offers
Domestic & International
-40% OFF
Tesamorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Tesamorelin GHRH / GHRF analog
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 44-amino-acid peptide
Elimination Half-Life ~8–11 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$42.00 $70.00
You will save $28.00
Tesamorelin 5 mg
British Dragon Pharmaceuticals
Product Details British Dragon
Active Substance Tesamorelin GHRH / GRF analogue
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes
Primary Target GHRH receptor Stimulates endogenous GH release
Out of stock
Tesamorelin 5 mg
Axiolabs
Product Details Axiolabs
Active Substance Tesamorelin GHRH / GHRF analog
Strength 5 mg/vial
Package 1 × 2 mL vial 5 mg total labeled content
Form Lyophilized powder
Drug Class GHRH analog
Peptide Type 44 amino acids
SC Half-Life ~8–11 minutes
Mechanism GHRH receptor agonist Stimulates GH release
Out of stock
Coming Soon!
Tesamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Tesamorelin GHRH / GRF analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes Formulation dependent
Primary Target GHRH receptor Pituitary GH axis
Out of stock
Kalpatropin HGH 200 IU
Kalpa Pharmaceuticals LTD, India
Product Details Kalpa Pharmaceuticals
Active Substance Somatropin Recombinant human growth hormone
Strength 20 IU/vial
Package 10 × 2 mL vials 200 IU total labeled content
Form Lyophilized powder For reconstitution
Drug Class Human growth hormone
Protein Length 191 amino acids
Hormone Type Recombinant hGH
Technology Recombinant DNA
Out of stock

Add to Cart - Product(s)

Close Button
Empty

Total Cost: