Peptide Hubs

Tesamorelin 5 mg

Product Details Peptide Hubs

Active Substance Tesamorelin GHRH / GRF analogue

Strength 10 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Drug Class GHRH analogue

Peptide Length 44 amino acids

SC Half-Life ~8–11 minutes Formulation dependent

Primary Target GHRH receptor Pituitary GH axis

Shipping Location :

International

U.S. Domestic

Out of stock

Buy Tesamorelin 5 mg from Peptide Hubs

Peptide Hubs Tesamorelin 5 mg delivers a research-grade synthetic growth hormone-releasing hormone (GHRH) analog, designed to stimulate the natural production of growth hormone (GH). Each 2 mL vial contains 5 mg of Tesamorelin, produced under strict quality standards for consistent research use.

What is Tesamorelin?

Tesamorelin is a stabilized analog of growth hormone-releasing hormone (GHRH) used in research to promote growth hormone secretion. It has been studied for reducing visceral fat, improving lipid profiles, and supporting anti-aging protocols [Clinical Study].

Key Benefits of Peptide Hubs Tesamorelin

Stimulates natural growth hormone production
Promotes visceral fat reduction and improved body composition
May enhance recovery, energy levels, and metabolic function
Supports anti-aging and rejuvenation research

Technical Details

Peptide Type

Stabilized GHRH Analogue

Peptide Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Peptide Length

44 Amino-Acid Residues

Parent Peptide

Human Growth Hormone-Releasing Hormone (GHRH)

Structural Modification

N-Terminal trans-3-Hexenoyl Group

Molecular Formula

C₂₂₁H₃₆₆N₇₂O₆₇S

Molecular Weight

5136 g/mol

CAS Number

218949-48-5

PubChem CID

16137828

Receptor Target

GHRH Receptor (GHRHR)

Signaling Pathway

GHRHR / Growth Hormone Axis

Dosage & Usage Guidelines

Research protocols typically involve subcutaneous administration of 1–2 mg daily, ideally administered before bedtime to mimic natural GH secretion cycles. Long-term research cycles (12+ weeks) are commonly employed. Professional supervision is strongly recommended for peptide research.

Other Peptide Hubs Products to Explore

Boost your growth hormone research by combining Tesamorelin with Sermorelin. Discover more cutting-edge peptides in the Peptide Hubs USA section.

Shipping & Product Authenticity

USA Domestic

4–5 business days

International

13–15 business days

Order Processing

24–48 business hours

Tracking

Tracking number provided

Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

✔ Orders are processed after payment confirmation
✔ USA Domestic shipping is typically faster when local stock is selected
✔ International orders include tracking, though update frequency may vary by destination
✔ Multiple warehouses may result in separate shipments when applicable

Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.

Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Tesamorelin used for?

Tesamorelin is used in research to stimulate natural growth hormone production, reduce visceral fat, improve metabolic profiles, and support anti-aging processes.

How do you dose Tesamorelin 5 mg?

Research protocols often use 1–2 mg of Tesamorelin administered subcutaneously daily, ideally before bedtime to align with natural GH secretion rhythms.

Is Tesamorelin safe to use?

Tesamorelin has demonstrated a favorable safety profile in clinical studies. Some users report mild side effects like fluid retention or joint stiffness. Research supervision is recommended.

Where can I buy authentic Peptide Hubs Tesamorelin?

You can purchase authentic Tesamorelin 5 mg from our Peptide Hubs USA section, featuring premium-grade peptides for research purposes.

No reviews found

Please log in to write Tesamorelin 5 mg review.

Related Offers

Domestic & International

-40% OFF

Dragon Pharma, Europe

Tesamorelin

Product Details Dragon Pharma

Active Substance Tesamorelin GHRH / GHRF analog

Strength 5 mg per vial

Package 1 × 2 mL vial 5 mg labeled content

Form Lyophilized powder

Peptide Class GHRH analog

Peptide Type 44-amino-acid peptide

Elimination Half-Life ~8–11 minutes

Mechanism GHRH receptor agonist Stimulates endogenous GH release

$42.00 ~~$70.00~~

British Dragon Pharmaceuticals

Tesamorelin 5 mg

Product Details British Dragon

Active Substance Tesamorelin GHRH / GRF analogue

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Drug Class GHRH analogue

Peptide Length 44 amino acids

SC Half-Life ~8–11 minutes

Primary Target GHRH receptor Stimulates endogenous GH release

Kalpa Pharmaceuticals LTD, India

Tesamorelin 5 mg

Product Details Kalpa Pharmaceuticals

Active Substance Tesamorelin GHRH / GHRF analogue

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Drug Class GHRH analogue

Peptide Length 44 amino acids

SC Half-Life ~8–11 minutes

Primary Target GHRH receptor Stimulates endogenous GH release

Axiolabs

Tesamorelin 5 mg

Product Details Axiolabs

Active Substance Tesamorelin GHRH / GHRF analog

Strength 5 mg/vial

Package 1 × 2 mL vial 5 mg total labeled content

Form Lyophilized powder

Drug Class GHRH analog

Peptide Type 44 amino acids

SC Half-Life ~8–11 minutes

Mechanism GHRH receptor agonist Stimulates GH release

Kalpa Pharmaceuticals LTD, India

Kalpatropin HGH 200 IU

Product Details Kalpa Pharmaceuticals

Active Substance Somatropin Recombinant human growth hormone

Strength 20 IU/vial

Package 10 × 2 mL vials 200 IU total labeled content

Form Lyophilized powder For reconstitution

Drug Class Human growth hormone

Protein Length 191 amino acids

Hormone Type Recombinant hGH

Technology Recombinant DNA

Tesamorelin 5 mg

Buy Tesamorelin 5 mg from Peptide Hubs

What is Tesamorelin?

Key Benefits of Peptide Hubs Tesamorelin

Technical Details

Dosage & Usage Guidelines

Other Peptide Hubs Products to Explore

Shipping & Product Authenticity

What to Expect

Storage

Frequently Asked Questions

No reviews found

Add to Cart - Product(s)