Trusted Dragon Pharma Tesamorelin Source
DragonPharma.Net offers genuine Tesamorelin by Dragon Pharma, formulated for those seeking natural growth hormone stimulation and enhanced metabolic function. Each vial contains 5 mg of bioactive peptide in a 2 mL format, ideal for daily subcutaneous use.
What is Tesamorelin?
Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). It works by stimulating the pituitary gland to increase the body's own production of human growth hormone (HGH), making it especially useful for fat loss, lean muscle gain, and vitality enhancement.
Originally studied for HIV-related lipodystrophy, Tesamorelin has gained attention among athletes and performance-focused individuals due to its ability to improve body composition, reduce visceral fat, and boost recovery. You can compare it with other GH-related compounds like CJC-1295 DAC or GHK-CU for a broader recovery protocol.
Technical Details
Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Parent Peptide
Human Growth Hormone-Releasing Hormone (GHRH)
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
Dosage & Usage Guidelines
Tesamorelin is administered via subcutaneous injection, typically once per day. Common dosages range from 1 mg to 2 mg daily, depending on treatment goals and body composition needs. The peptide is most effective when used in a fasted state, ideally before bedtime or early morning to sync with natural GH secretion peaks.
Example Tesamorelin Cycle
A typical cycle may run for 8–12 weeks with daily dosing:
- Weeks 1–12: 1 mg daily, subcutaneously
- Stacking with fat-loss peptides like AOD 9604 is common during body recomposition phases
As Tesamorelin doesn't suppress natural testosterone or endocrine function, no PCT is required.
Benefits of Tesamorelin
- Improved GH secretion and IGF-1 levels
- Reduction in visceral fat and body mass index (BMI)
- Enhanced metabolic activity and energy regulation
- Support for muscle recovery and sleep quality
For more growth-focused stacks, explore our full Peptides collection or check our premium Dragon Pharma gear trusted by performance-driven users worldwide.
Possible Side Effects
Tesamorelin is well tolerated in most cases. Mild side effects may include:
- Injection site discomfort or redness
- Headaches, dizziness, or temporary water retention
- Nausea (typically dose-dependent)
Rare but serious adverse effects should be reviewed with a licensed healthcare provider. For more safety information, see the Drugs.com Tesamorelin profile.
Why Choose Dragon Pharma Tesamorelin?
Dragon Pharma is known for precision dosing, clinical-grade peptides, and rigorous quality testing. Each batch of Tesamorelin undergoes independent verification to ensure purity and peptide integrity. Whether you're seeking fat reduction or anabolic enhancement via natural GH production, Tesamorelin is a cornerstone option.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma Tesamorelin used for?
Tesamorelin is used to stimulate natural growth hormone production, improve body composition, reduce visceral fat, and enhance recovery. It's commonly used by athletes and individuals seeking metabolic or anti-aging benefits.
How do you take Tesamorelin?
Tesamorelin is administered by subcutaneous injection once daily, typically in the abdominal area. Doses range from 1 to 2 mg per day, depending on goals and body composition needs.
Does Tesamorelin require PCT?
No, Tesamorelin does not suppress testosterone or disrupt endocrine function, so post-cycle therapy (PCT) is not required. It mimics natural hormone signaling without interference.
What are the side effects of Tesamorelin?
Mild side effects may include injection site irritation, water retention, headache, or nausea. These effects are usually short-lived. Serious effects are rare but should be reported to a doctor.
Where can I buy Dragon Pharma Tesamorelin?
You can purchase Dragon Pharma Tesamorelin from our secure online store. All products are independently lab-tested and shipped discreetly across the USA and internationally.
Tesamorelin Reviews
Please log in to write Tesamorelin review.
January 12, 2025
My weight loss journey got a huge boost with Tesamorelin. My energy is through the roof, and I’m motivated for every workout.