Tesamorelin
Peptides

Tesamorelin

Product Details Dragon Pharma
Active Substance Tesamorelin GHRH / GHRF analog
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 44-amino-acid peptide
Elimination Half-Life ~8–11 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$42.00 $70.00
Shipping Location :
International
U.S. Domestic
You will save $28.00

Trusted Dragon Pharma Tesamorelin Source

DragonPharma.Net offers genuine Tesamorelin by Dragon Pharma, formulated for those seeking natural growth hormone stimulation and enhanced metabolic function. Each vial contains 5 mg of bioactive peptide in a 2 mL format, ideal for daily subcutaneous use.

What is Tesamorelin?

Tesamorelin is a synthetic peptide analog of growth hormone-releasing hormone (GHRH). It works by stimulating the pituitary gland to increase the body's own production of human growth hormone (HGH), making it especially useful for fat loss, lean muscle gain, and vitality enhancement.

Originally studied for HIV-related lipodystrophy, Tesamorelin has gained attention among athletes and performance-focused individuals due to its ability to improve body composition, reduce visceral fat, and boost recovery. You can compare it with other GH-related compounds like CJC-1295 DAC or GHK-CU for a broader recovery protocol.

Technical Details

Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Parent Peptide
Human Growth Hormone-Releasing Hormone (GHRH)
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
CAS Number
218949-48-5
PubChem CID
16137828
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis

Dosage & Usage Guidelines

Tesamorelin is administered via subcutaneous injection, typically once per day. Common dosages range from 1 mg to 2 mg daily, depending on treatment goals and body composition needs. The peptide is most effective when used in a fasted state, ideally before bedtime or early morning to sync with natural GH secretion peaks.

Example Tesamorelin Cycle

A typical cycle may run for 8–12 weeks with daily dosing:

  • Weeks 1–12: 1 mg daily, subcutaneously
  • Stacking with fat-loss peptides like AOD 9604 is common during body recomposition phases

As Tesamorelin doesn't suppress natural testosterone or endocrine function, no PCT is required.

Benefits of Tesamorelin

  • Improved GH secretion and IGF-1 levels
  • Reduction in visceral fat and body mass index (BMI)
  • Enhanced metabolic activity and energy regulation
  • Support for muscle recovery and sleep quality

For more growth-focused stacks, explore our full Peptides collection or check our premium Dragon Pharma gear trusted by performance-driven users worldwide.

Possible Side Effects

Tesamorelin is well tolerated in most cases. Mild side effects may include:

  • Injection site discomfort or redness
  • Headaches, dizziness, or temporary water retention
  • Nausea (typically dose-dependent)

Rare but serious adverse effects should be reviewed with a licensed healthcare provider. For more safety information, see the Drugs.com Tesamorelin profile.

Why Choose Dragon Pharma Tesamorelin?

Dragon Pharma is known for precision dosing, clinical-grade peptides, and rigorous quality testing. Each batch of Tesamorelin undergoes independent verification to ensure purity and peptide integrity. Whether you're seeking fat reduction or anabolic enhancement via natural GH production, Tesamorelin is a cornerstone option.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • ✔ Orders are processed after payment confirmation
  • ✔ USA Domestic shipping is typically faster when local stock is selected
  • ✔ International orders include tracking, though update frequency may vary by destination
  • ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Dragon Pharma Tesamorelin used for?

Tesamorelin is used to stimulate natural growth hormone production, improve body composition, reduce visceral fat, and enhance recovery. It's commonly used by athletes and individuals seeking metabolic or anti-aging benefits.

How do you take Tesamorelin?

Tesamorelin is administered by subcutaneous injection once daily, typically in the abdominal area. Doses range from 1 to 2 mg per day, depending on goals and body composition needs.

Does Tesamorelin require PCT?

No, Tesamorelin does not suppress testosterone or disrupt endocrine function, so post-cycle therapy (PCT) is not required. It mimics natural hormone signaling without interference.

What are the side effects of Tesamorelin?

Mild side effects may include injection site irritation, water retention, headache, or nausea. These effects are usually short-lived. Serious effects are rare but should be reported to a doctor.

Where can I buy Dragon Pharma Tesamorelin?

You can purchase Dragon Pharma Tesamorelin from our secure online store. All products are independently lab-tested and shipped discreetly across the USA and internationally.

Tesamorelin Reviews

Jason
January 12, 2025

My weight loss journey got a huge boost with Tesamorelin. My energy is through the roof, and I’m motivated for every workout.

Rachel
December 29, 2024

This supplement has improved my mental clarity and made it easier to balance my fitness routine. Tesamorelin works wonders.

Amanda
December 15, 2024

Burning fat and keeping energy levels high is easier with Tesamorelin. I’m recovering faster and feel mentally sharper.

Ethan
December 3, 2024

Tesamorelin has helped me stay fit and motivated. My body composition is leaner, and my workouts are more rewarding.

Sara
November 21, 2024

After including Tesamorelin in my regimen, my metabolism is consistent, and my energy stays steady all day.

Mark
November 7, 2024

With Tesamorelin, my weight loss journey feels manageable and efficient. I’m more resilient and motivated daily.

Lisa
October 24, 2024

I’m burning fat while maintaining muscle thanks to Tesamorelin. My confidence and energy are higher than before.

Chris
October 10, 2024

Tesamorelin keeps me focused and motivated to hit my weight loss goals. My overall strength and stamina have improved.

Laura
September 28, 2024

This supplement made my recovery faster and allowed me to push my limits in the gym. Tesamorelin is essential.

Paul
September 14, 2024

Tesamorelin is amazing! It’s helped me stay on top of my fitness routine and shed stubborn fat around my belly.

Megan
September 2, 2024

My workouts feel more effective with Tesamorelin. I’m burning fat and maintaining muscle without feeling drained.

Anthony
August 21, 2024

The boost Tesamorelin gives me keeps my metabolism going strong, and I'm finding it easier to reach my fitness targets.

Karen
August 9, 2024

Tesamorelin has helped me get back on track with my weight loss goals and maintain consistent energy throughout the day.

John
July 26, 2024

After a few weeks of Tesamorelin, my muscle tone has improved, and I’m less fatigued. It’s a game-changer for workouts!

Olivia
July 14, 2024

Tesamorelin made it easier to shed excess weight. I'm more focused and energetic while meeting my fitness goals.

Kevin
July 2, 2024

My metabolism has improved, and my weight loss is steady since using Tesamorelin. I feel revitalized every day!

Emily
June 18, 2024

I can now train harder and longer, thanks to Tesamorelin. It's helped me build lean muscle while cutting excess fat.

Robert
June 5, 2024

Since starting Tesamorelin, I’ve noticed a drop in belly fat and a boost in energy. It’s helped me stay consistent.

Jessica
May 24, 2024

This supplement aided my weight loss journey significantly. I’m shedding fat faster and feel more focused with Tesamorelin.

Brian
May 12, 2024

Tesamorelin has helped me lean out and maintain muscle mass. My energy levels are up, and my workouts feel effortless.

Please log in to write Tesamorelin review.

Related Offers
Domestic & International
-40% OFF
Sermorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Sermorelin GHRH(1–29)-NH₂
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 29-amino-acid peptide GHRH fragment 1–29
Plasma Half-Life ~10–20 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$27.00 $45.00
You will save $18.00
Domestic & International
-40% OFF
MOTS-c 10 mg
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance MOTS-c Mitochondrial-derived peptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Mitochondrial peptide
Peptide Type 16-amino-acid peptide Mitochondrial 12S rRNA encoded
Human Half-Life Not established
Research Focus Metabolic signaling AMPK-associated pathways
$42.00 $70.00
You will save $28.00
Lab Tested
Domestic & International
-40% OFF
Ipamorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Ipamorelin Growth hormone secretagogue
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class GH secretagogue
Peptide Type Pentapeptide 5 amino-acid residues
IV Half-Life Approximately 2 hours
Development Status Investigational
Latest laboratory result 5.60 mg November 20, 2023 · 112.00% of 5 mg label claim · Batch HDIPM923 View
$27.00 $45.00
You will save $18.00
Lab Tested
Shipped USA Domestic
-40% OFF
IGF-1 LR3
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance IGF-1 LR3 Long R3 Insulin-Like Growth Factor-I
Strength 1 mg per vial
Package 1 × 2 mL vial 1 mg labeled content
Form Lyophilized powder
Research Class IGF-1 analog
Peptide Structure 83 amino acids Modified human IGF-1
Human Half-Life Not established
Development Status Research compound
Latest laboratory result 1.05 mg January 19, 2024 · 105.00% of 1 mg label claim View
$78.00 $130.00
You will save $52.00
Domestic & International
-40% OFF
CJC-1295 DAC
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance CJC-1295 DAC Long-acting GHRH analog
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class GHRH analog
Modification DAC conjugate Drug Affinity Complex
Estimated Half-Life Approximately 6–8 days
Development Status Investigational
$39.00 $65.00
You will save $26.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: