Sermorelin
Peptides

Sermorelin

Product Details Dragon Pharma
Active Substance Sermorelin GHRH(1–29)-NH₂
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 29-amino-acid peptide GHRH fragment 1–29
Plasma Half-Life ~10–20 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$27.00 $45.00
Shipping Location :
International
U.S. Domestic
You will save $18.00

Clinically Trusted Sermorelin 5 mg by Dragon Pharma

DragonPharma.Net is your reliable source for research-grade peptides. We offer only authentic Sermorelin 5 mg by Dragon Pharma, designed to promote natural growth hormone release and enhance recovery, performance, and longevity.

What is Sermorelin?

Sermorelin is a synthetic analog of Growth Hormone-Releasing Hormone (GHRH), developed to stimulate the anterior pituitary gland to produce more endogenous growth hormone (GH). Dragon Pharma's Sermorelin 5 mg is packaged in a 2 mL lyophilized vial, intended for subcutaneous reconstitution and administration.

Unlike exogenous HGH, Sermorelin works by activating your body's own growth hormone production, which supports a more regulated and sustainable increase in circulating GH levels.

How Does Sermorelin Work?

Sermorelin mimics the natural GHRH peptide and binds to specific receptors in the pituitary gland. This activation leads to:

  • Increased growth hormone (GH) secretion
  • Enhanced IGF-1 production
  • Improved tissue repair, muscle growth, and recovery
  • Better sleep quality and metabolic function

It is often favored for long-term anti-aging protocols and natural performance enhancement.

Technical Details

Peptide Type
Synthetic GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Peptide Length
29 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NH₂)
Structural Origin
Human GHRH Residues 1–29
Molecular Formula
C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight
3357.9 g/mol
CAS Number
86168-78-7
PubChem CID
16129608
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis

Dosage & Usage Guidelines

  • Dosage: 200–300 mcg per day
  • Cycle Length: 8 to 12 weeks for performance or anti-aging benefits
  • Administration: Subcutaneous injection, preferably in the evening to mimic natural GH pulsatile release

This protocol can be customized based on goals, and it may be combined with GHK-CU or GHRP-6 for synergistic GH stimulation.

Does Sermorelin Require Post-Cycle Therapy?

Sermorelin does not suppress endogenous testosterone or hormone production, and therefore does not require traditional PCT. However, it is recommended to cycle Sermorelin or taper off gradually to allow the body to stabilize naturally. Our official Dragon Pharma supplier portal offers guidance and additional resources for safe cycling strategies.

Benefits of Sermorelin by Dragon Pharma

  • Increases lean muscle mass and recovery capacity
  • Promotes fat metabolism and energy balance
  • Supports better sleep, immune function, and skin regeneration
  • Provides a safer alternative to synthetic HGH

Potential Side Effects

While well-tolerated, some users may experience mild side effects such as:

  • Injection site irritation
  • Temporary headaches or dizziness
  • Flushing or fatigue in rare cases

These symptoms typically resolve quickly. Monitoring and dosage adjustments can be made under supervision of a healthcare professional.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • ✔ Orders are processed after payment confirmation
  • ✔ USA Domestic shipping is typically faster when local stock is selected
  • ✔ International orders include tracking, though update frequency may vary by destination
  • ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Sermorelin used for?

Sermorelin is used to stimulate the natural release of growth hormone, which supports muscle development, fat loss, and anti-aging benefits.

How do I take Sermorelin?

Sermorelin is typically injected subcutaneously at doses of 200–300 mcg daily, usually in the evening to mimic natural GH release cycles.

Does Sermorelin require a PCT?

No. Sermorelin supports natural GH secretion and doesn't suppress testosterone or HPTA, so it doesn't require post-cycle therapy.

Is Sermorelin safe for long-term use?

Yes, Sermorelin is well-tolerated when used correctly. However, dosage and cycle duration should be guided by a healthcare professional.

Sermorelin Reviews

B***e.
December 30, 2024

Sermorelin has been excellent for my fitness and recovery. I feel stronger and more capable of hitting my targets.

S***e.
December 18, 2024

My energy and strength levels have been revitalized with Sermorelin. I’ve noticed solid muscle gains in a short time.

V***r.
December 6, 2024

Sermorelin is my go-to for stamina and vitality. I feel more alert and motivated, which positively affects my productivity.

A***y.
November 24, 2024

With Sermorelin, my workout performance is consistent and robust. My quality of life has improved drastically.

M***s.
November 12, 2024

I'm seeing steady gains in muscle mass and recovery time. Sermorelin made it easy to stay motivated and hit my goals.

A***a.
October 30, 2024

Sermorelin gives me the vitality I need to stay focused and productive throughout the day. It’s been transformative.

E***n.
October 18, 2024

Sermorelin has made my fitness journey more enjoyable. My metabolism is fast, and I feel full of energy every day.

L***a.
October 6, 2024

I wake up feeling more refreshed, and my workouts have been stellar since starting Sermorelin. A real game-changer.

D***l.
September 22, 2024

The strength gains with Sermorelin are incredible. My recovery is smooth, and I can push myself without getting overly tired.

O***a.
September 10, 2024

Sermorelin has improved my energy levels and helped me stay on track with my fitness goals. My progress is consistent.

L***e.
August 29, 2024

Recovery is now quicker and more consistent. Sermorelin also gave me a confidence boost, which helps tackle new challenges.

R***l.
August 15, 2024

Sermorelin enhanced my mental clarity and helped me overcome fatigue. I feel more positive and productive.

N***e.
August 3, 2024

The improvements in energy and strength with Sermorelin have made my training sessions far more effective. Worth every penny!

K***n.
July 21, 2024

Sermorelin made my fitness journey smoother. My motivation is up, and my ability to handle stress has improved significantly.

S***h.
July 9, 2024

Great energy boost with Sermorelin! I've noticed quicker recovery times after intense workouts. No more sluggishness.

J***n.
June 28, 2024

My stamina and endurance improved dramatically. Sermorelin has rejuvenated me, and I feel ready for anything.

E***a.
June 15, 2024

My metabolism has been on fire since incorporating Sermorelin into my regimen. Feeling healthier and more vibrant overall.

G***e.
June 3, 2024

Since starting Sermorelin, I've felt more energetic and motivated to push myself during exercise. My performance is stellar.

B***h.
May 22, 2024

I've noticed substantial changes in my recovery time and endurance after a few weeks of using Sermorelin. It's now a staple.

A***x.
May 12, 2024

Sermorelin gave me a new burst of energy! I'm sleeping better, and my workouts have improved significantly. Highly recommended.

Please log in to write Sermorelin review.

Related Offers
Domestic & International
-40% OFF
MOTS-c 10 mg
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance MOTS-c Mitochondrial-derived peptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Mitochondrial peptide
Peptide Type 16-amino-acid peptide Mitochondrial 12S rRNA encoded
Human Half-Life Not established
Research Focus Metabolic signaling AMPK-associated pathways
$42.00 $70.00
You will save $28.00
Lab Tested
Domestic & International
-40% OFF
Ipamorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Ipamorelin Growth hormone secretagogue
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class GH secretagogue
Peptide Type Pentapeptide 5 amino-acid residues
IV Half-Life Approximately 2 hours
Development Status Investigational
Latest laboratory result 5.60 mg November 20, 2023 · 112.00% of 5 mg label claim · Batch HDIPM923 View
$27.00 $45.00
You will save $18.00
Lab Tested
Shipped USA Domestic
-40% OFF
IGF-1 LR3
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance IGF-1 LR3 Long R3 Insulin-Like Growth Factor-I
Strength 1 mg per vial
Package 1 × 2 mL vial 1 mg labeled content
Form Lyophilized powder
Research Class IGF-1 analog
Peptide Structure 83 amino acids Modified human IGF-1
Human Half-Life Not established
Development Status Research compound
Latest laboratory result 1.05 mg January 19, 2024 · 105.00% of 1 mg label claim View
$78.00 $130.00
You will save $52.00
Domestic & International
-40% OFF
CJC-1295 DAC
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance CJC-1295 DAC Long-acting GHRH analog
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class GHRH analog
Modification DAC conjugate Drug Affinity Complex
Estimated Half-Life Approximately 6–8 days
Development Status Investigational
$39.00 $65.00
You will save $26.00
Domestic & International
-40% OFF
Tesamorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Tesamorelin GHRH / GHRF analog
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 44-amino-acid peptide
Elimination Half-Life ~8–11 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$42.00 $70.00
You will save $28.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: