Clinically Trusted Sermorelin 5 mg by Dragon Pharma
DragonPharma.Net is your reliable source for research-grade peptides. We offer only authentic Sermorelin 5 mg by Dragon Pharma, designed to promote natural growth hormone release and enhance recovery, performance, and longevity.
What is Sermorelin?
Sermorelin is a synthetic analog of Growth Hormone-Releasing Hormone (GHRH), developed to stimulate the anterior pituitary gland to produce more endogenous growth hormone (GH). Dragon Pharma's Sermorelin 5 mg is packaged in a 2 mL lyophilized vial, intended for subcutaneous reconstitution and administration.
Unlike exogenous HGH, Sermorelin works by activating your body's own growth hormone production, which supports a more regulated and sustainable increase in circulating GH levels.
How Does Sermorelin Work?
Sermorelin mimics the natural GHRH peptide and binds to specific receptors in the pituitary gland. This activation leads to:
- Increased growth hormone (GH) secretion
- Enhanced IGF-1 production
- Improved tissue repair, muscle growth, and recovery
- Better sleep quality and metabolic function
It is often favored for long-term anti-aging protocols and natural performance enhancement.
Technical Details
Peptide Type
Synthetic GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Peptide Length
29 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NH₂)
Structural Origin
Human GHRH Residues 1–29
Molecular Formula
C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight
3357.9 g/mol
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
Dosage & Usage Guidelines
- Dosage: 200–300 mcg per day
- Cycle Length: 8 to 12 weeks for performance or anti-aging benefits
- Administration: Subcutaneous injection, preferably in the evening to mimic natural GH pulsatile release
This protocol can be customized based on goals, and it may be combined with GHK-CU or GHRP-6 for synergistic GH stimulation.
Does Sermorelin Require Post-Cycle Therapy?
Sermorelin does not suppress endogenous testosterone or hormone production, and therefore does not require traditional PCT. However, it is recommended to cycle Sermorelin or taper off gradually to allow the body to stabilize naturally. Our official Dragon Pharma supplier portal offers guidance and additional resources for safe cycling strategies.
Benefits of Sermorelin by Dragon Pharma
- Increases lean muscle mass and recovery capacity
- Promotes fat metabolism and energy balance
- Supports better sleep, immune function, and skin regeneration
- Provides a safer alternative to synthetic HGH
Potential Side Effects
While well-tolerated, some users may experience mild side effects such as:
- Injection site irritation
- Temporary headaches or dizziness
- Flushing or fatigue in rare cases
These symptoms typically resolve quickly. Monitoring and dosage adjustments can be made under supervision of a healthcare professional.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Sermorelin used for?
Sermorelin is used to stimulate the natural release of growth hormone, which supports muscle development, fat loss, and anti-aging benefits.
How do I take Sermorelin?
Sermorelin is typically injected subcutaneously at doses of 200–300 mcg daily, usually in the evening to mimic natural GH release cycles.
Does Sermorelin require a PCT?
No. Sermorelin supports natural GH secretion and doesn't suppress testosterone or HPTA, so it doesn't require post-cycle therapy.
Is Sermorelin safe for long-term use?
Yes, Sermorelin is well-tolerated when used correctly. However, dosage and cycle duration should be guided by a healthcare professional.
Sermorelin Reviews
Please log in to write Sermorelin review.
December 30, 2024
Sermorelin has been excellent for my fitness and recovery. I feel stronger and more capable of hitting my targets.