British Dragon Tesamorelin 5 mg – Potent GHRH Analog
β High-purity lyophilized powder β 5 mg per 2 mL vial β Potent GHRH (1-44) analog β USA & International shipping
British Dragon Tesamorelin 5 mg is a synthetic analog of growth hormone-releasing hormone (GHRH), specifically the full-length GHRH (1-44) sequence with a chemical modification that enhances its resistance to enzymatic degradation. Each 2 mL vial contains 5 mg of lyophilized Tesamorelin, designed for reconstitution in research settings investigating metabolic function, body composition, and growth hormone regulation.
Tesamorelin acts on the pituitary somatotrophs to stimulate endogenous growth hormone release with greater potency and duration than shorter GHRH analogs. For researchers studying visceral adiposity and metabolic parameters, this peptide offers distinct advantages. Explore similar research compounds like Sermorelin 5 mg or Ipamorelin 5 mg.
What Makes British Dragon Tesamorelin Unique?
Tesamorelin contains a trans-3-hexenoic acid modification at the N-terminus, which confers resistance to dipeptidyl peptidase-4 (DPP-4) degradation, resulting in a longer half-life compared to unmodified GHRH (1-44). This modification allows for once-daily administration in research protocols while maintaining biological activity.
For metabolic research, Tesamorelin has been extensively studied for its effects on visceral adipose tissue and metabolic parameters. The 5 mg dosage provides sufficient material for extended research protocols investigating chronic GHRH analog administration. Researchers may also compare Tesamorelin with Sermorelin to evaluate differences between GHRH fragments and full-length analogs.
Benefits of British Dragon Tesamorelin for Research
- β Full-length GHRH (1-44) analog with enhanced stability
- β DPP-4 resistant for extended duration of action
- β 5 mg lyophilized powder for reconstitution flexibility
- β Suitable for subcutaneous administration research
- β Relevant for metabolic and body composition studies
Research Grade
British Dragon Tesamorelin 5 mg is intended for laboratory research only. Not for human consumption or clinical use.
External research on Tesamorelin's mechanisms can be explored via PubMed for peer-reviewed studies.
Technical Details
Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Parent Peptide
Human Growth Hormone-Releasing Hormone (GHRH)
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
CβββHβββNββOββS
Molecular Weight
5136 g/mol
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
Dosage & Usage Guidelines for Research
For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.
Reconstitution Protocol
- β Add 2-3 mL bacteriostatic water to the 5 mg vial
- β Swirl gently; do not shake
- β Store reconstituted peptide at 2-8°C and use within 30 days
The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL (1670-2500 mcg/mL). For precise dosing, researchers should calculate based on desired mg per injection volume.
Typical Research Parameters
In animal models, Tesamorelin is often administered at dosages ranging from 1-2 mg per day. Due to its approximately 2-hour half-life, once-daily administration is typical in prolonged studies. Subcutaneous injection is the standard route for systemic absorption research.
- β Subcutaneous injection: 1-2 mg once daily
- β Research models: Dosing typically scaled by body weight
- β Study duration: 4-12 weeks for metabolic and body composition studies
Combination Research
Tesamorelin is often studied in isolation for its effects on GH release and metabolic parameters. However, some protocols combine it with GHRP compounds to evaluate synergistic effects on GH pulsatility. For comprehensive metabolic research, explore our range of MOTS-c 10 mg.
Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.
What to Avoid During Research
- β Do not use if the lyophilized cake appears discolored or collapsed
- β Avoid exposure to high heat or direct light
- β Do not mix with strong solvents or extreme pH solutions
- β Avoid repeated freeze-thaw cycles after reconstitution
Shipping & Product Authenticity
USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official British Dragon distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- β Orders are processed after payment confirmation
- β USA Domestic shipping is typically faster when local stock is selected
- β International orders include tracking, though update frequency may vary by destination
- β Multiple warehouses may result in separate shipments when applicable
Authenticity support: official British Dragon presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage Guidelines for Lyophilized Peptides
Store British Dragon Tesamorelin 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.
After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.
Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.
Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.
Frequently Asked Questions
What is British Dragon Tesamorelin 5 mg used for in research?
Tesamorelin is studied as a potent GHRH analog that stimulates endogenous growth hormone release. Research applications include metabolic studies, visceral adiposity investigations, and body composition research in animal models.
How is British Dragon Tesamorelin typically reconstituted?
Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.
What is the typical research dosage for Tesamorelin?
In animal studies, dosages often range from 1-2 mg per day, administered once daily due to the approximately 2-hour half-life. Dosing should be scaled appropriately for the research model and study objectives.
How is Tesamorelin different from Sermorelin?
Tesamorelin is a full-length GHRH (1-44) analog with a chemical modification that confers DPP-4 resistance and a longer half-life. Sermorelin is a shorter GHRH (1-29) fragment without this modification, resulting in different pharmacokinetic properties.
Is British Dragon Tesamorelin tested for purity?
Third-party COA testing is currently pending. British Dragon is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.
No reviews found
Please log in to write Tesamorelin 5 mg review.