Sermorelin 5 mg
Kalpa Pharmaceuticals

Sermorelin 5 mg

Product Details Kalpa Pharmaceuticals
Active Substance Sermorelin GHRH (1–29) analogue
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Plasma Half-Life ~10–20 minutes
Primary Target GHRH receptor Stimulates endogenous GH release
Shipping Location :
International
U.S. Domestic
Out of stock

Kalpa Pharmaceuticals Sermorelin 5 mg – GHRH Analog for Growth Hormone Research

βœ” High-purity lyophilized powder βœ” 5 mg per 2 mL vial βœ” GHRH (1-29) analog βœ” USA & International shipping

Kalpa Pharmaceuticals Sermorelin 5 mg is a synthetic analog of growth hormone-releasing hormone (GHRH), specifically the biologically active fragment GHRH (1-29). Each 2 mL vial contains 5 mg of lyophilized Sermorelin, designed for reconstitution in research settings investigating growth hormone regulation and pulsatile secretion patterns.

Sermorelin acts directly on the pituitary somatotrophs to stimulate endogenous growth hormone release, mimicking the natural GHRH mechanism. For researchers studying the hypothalamic-pituitary axis, this peptide provides a targeted tool for GH pulse manipulation. Explore similar research compounds like Ipamorelin 5 mg or Tesamorelin 5 mg.

What Makes Kalpa Pharmaceuticals Sermorelin Unique?

As a GHRH analog, Sermorelin represents the N-terminal fragment of endogenous GHRH (1-44), retaining full biological activity while offering a shorter peptide sequence. Unlike GHRP compounds that act on the ghrelin receptor, Sermorelin targets GHRH receptors directly, providing a distinct mechanism for stimulating GH release.

For performance-focused research, Sermorelin is often studied in combination with GHRP analogs to evaluate synergistic effects on GH pulsatility. The 5 mg dosage provides flexibility for both acute and extended research protocols. Researchers may also compare Sermorelin with Tesamorelin to evaluate differences between GHRH analogs.

Benefits of Kalpa Pharmaceuticals Sermorelin for Research

  • βœ” Direct GHRH receptor agonist for targeted GH research
  • βœ” Biologically active fragment of endogenous GHRH
  • βœ” 5 mg lyophilized powder for reconstitution flexibility
  • βœ” Suitable for subcutaneous administration research
  • βœ” Can be stacked with GHRP compounds for synergy studies
Research Grade

Kalpa Pharmaceuticals Sermorelin 5 mg is intended for laboratory research only. Not for human consumption or clinical use.

External research on Sermorelin's mechanisms can be explored via PubMed for peer-reviewed studies.

Technical Details

Peptide Type
Synthetic GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NHβ‚‚
Peptide Length
29 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NHβ‚‚)
Structural Origin
Human GHRH Residues 1–29
Molecular Formula
C₁₄₉H₂₄₆Nβ‚„β‚„Oβ‚„β‚‚S
Molecular Weight
3357.9 g/mol
CAS Number
86168-78-7
PubChem CID
16129608
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis

Dosage & Usage Guidelines for Research

For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.

Reconstitution Protocol

  • βœ” Add 2-3 mL bacteriostatic water to the 5 mg vial
  • βœ” Swirl gently; do not shake
  • βœ” Store reconstituted peptide at 2-8°C and use within 30 days

The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL (1670-2500 mcg/mL). For precise dosing, researchers should calculate based on desired mcg per injection volume.

Typical Research Parameters

In animal models, Sermorelin is often administered at dosages ranging from 100-500 mcg per injection. Due to its short half-life, multiple daily administrations are common in prolonged studies. Subcutaneous injection is the standard route for systemic absorption research.

  • βœ” Subcutaneous injection: 100-500 mcg once or twice daily
  • βœ” Research models: Rodent dosing typically scaled by body weight
  • βœ” Study duration: 4-8 weeks for chronic GH elevation studies

Combination Research

Sermorelin is frequently studied alongside GHRP compounds like Ipamorelin or GHRP-2 to evaluate synergistic effects on GH release. This combination can produce amplified GH pulses compared to either peptide alone. For stacking protocols, Ipamorelin 5 mg can be reconstituted and administered concurrently.

Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.

What to Avoid During Research

  • ❌ Do not use if the lyophilized cake appears discolored or collapsed
  • ❌ Avoid administration with high-fat meals in oral absorption studies
  • ❌ Do not mix with strong acidic or basic solutions
  • ❌ Avoid repeated freeze-thaw cycles after reconstitution

Shipping & Product Authenticity

USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Kalpa Pharmaceuticals distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Kalpa Pharmaceuticals presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage Guidelines for Lyophilized Peptides

Store Kalpa Pharmaceuticals Sermorelin 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.

After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.

Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.

Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Kalpa Pharmaceuticals Sermorelin 5 mg used for in research?

Sermorelin is studied as a GHRH analog that stimulates endogenous growth hormone release via direct action on pituitary somatotrophs. Research applications include GH pulse regulation, hypothalamic-pituitary axis studies, and metabolic investigations in animal models.

How is Kalpa Pharmaceuticals Sermorelin typically reconstituted?

Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.

What is the typical research dosage for Sermorelin?

In animal studies, dosages often range from 100-500 mcg per injection, administered once or twice daily. Dosing should be scaled appropriately for the research model and study objectives.

Can Sermorelin be stacked with other peptides?

Yes. Sermorelin is commonly studied alongside GHRP compounds such as Ipamorelin or GHRP-2 to evaluate synergistic effects on GH pulsatility and release patterns.

Is Kalpa Pharmaceuticals Sermorelin tested for purity?

Third-party COA testing is currently pending. Kalpa Pharmaceuticals is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.

No reviews found

Please log in to write Sermorelin 5 mg review.

Related Offers
Sermorelin 5 mg
British Dragon Pharmaceuticals
Product Details British Dragon
Active Substance Sermorelin GHRH (1–29) analogue
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
SC Half-Life ~11–12 minutes
Primary Target GHRH receptor Stimulates endogenous GH release
Out of stock
Lab Tested
Shipped International
-40% OFF
Sermorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
$24.00 $40.00
You will save $16.00
Domestic & International
-40% OFF
Sermorelin
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Sermorelin GHRH(1–29)-NHβ‚‚
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Peptide Class GHRH analog
Peptide Type 29-amino-acid peptide GHRH fragment 1–29
Plasma Half-Life ~10–20 minutes
Mechanism GHRH receptor agonist Stimulates endogenous GH release
$27.00 $45.00
You will save $18.00
Sermorelin 5 mg
Axiolabs
Product Details Axiolabs
Active Substance Sermorelin GHRH (1–29)
Strength 5 mg/vial
Package 1 × 2 mL vial 5 mg total labeled content
Form Lyophilized powder
Research Class GHRH analog
Peptide Type 29 amino acids
SC Half-Life ~11–12 minutes
Mechanism GHRH receptor agonist Stimulates GH release
Out of stock
Kalpatropin HGH 200 IU
Kalpa Pharmaceuticals LTD, India
Product Details Kalpa Pharmaceuticals
Active Substance Somatropin Recombinant human growth hormone
Strength 20 IU/vial
Package 10 × 2 mL vials 200 IU total labeled content
Form Lyophilized powder For reconstitution
Drug Class Human growth hormone
Protein Length 191 amino acids
Hormone Type Recombinant hGH
Technology Recombinant DNA
Out of stock

Add to Cart - Product(s)

Close Button
Empty

Total Cost: