Kalpa Pharmaceuticals Sermorelin 5 mg – GHRH Analog for Growth Hormone Research
β High-purity lyophilized powder β 5 mg per 2 mL vial β GHRH (1-29) analog β USA & International shipping
Kalpa Pharmaceuticals Sermorelin 5 mg is a synthetic analog of growth hormone-releasing hormone (GHRH), specifically the biologically active fragment GHRH (1-29). Each 2 mL vial contains 5 mg of lyophilized Sermorelin, designed for reconstitution in research settings investigating growth hormone regulation and pulsatile secretion patterns.
Sermorelin acts directly on the pituitary somatotrophs to stimulate endogenous growth hormone release, mimicking the natural GHRH mechanism. For researchers studying the hypothalamic-pituitary axis, this peptide provides a targeted tool for GH pulse manipulation. Explore similar research compounds like Ipamorelin 5 mg or Tesamorelin 5 mg.
What Makes Kalpa Pharmaceuticals Sermorelin Unique?
As a GHRH analog, Sermorelin represents the N-terminal fragment of endogenous GHRH (1-44), retaining full biological activity while offering a shorter peptide sequence. Unlike GHRP compounds that act on the ghrelin receptor, Sermorelin targets GHRH receptors directly, providing a distinct mechanism for stimulating GH release.
For performance-focused research, Sermorelin is often studied in combination with GHRP analogs to evaluate synergistic effects on GH pulsatility. The 5 mg dosage provides flexibility for both acute and extended research protocols. Researchers may also compare Sermorelin with Tesamorelin to evaluate differences between GHRH analogs.
Benefits of Kalpa Pharmaceuticals Sermorelin for Research
- β Direct GHRH receptor agonist for targeted GH research
- β Biologically active fragment of endogenous GHRH
- β 5 mg lyophilized powder for reconstitution flexibility
- β Suitable for subcutaneous administration research
- β Can be stacked with GHRP compounds for synergy studies
Research Grade
Kalpa Pharmaceuticals Sermorelin 5 mg is intended for laboratory research only. Not for human consumption or clinical use.
External research on Sermorelin's mechanisms can be explored via PubMed for peer-reviewed studies.
Technical Details
Peptide Type
Synthetic GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NHβ
Peptide Length
29 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NHβ)
Structural Origin
Human GHRH Residues 1–29
Molecular Formula
CβββHβββNββOββS
Molecular Weight
3357.9 g/mol
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
Dosage & Usage Guidelines for Research
For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.
Reconstitution Protocol
- β Add 2-3 mL bacteriostatic water to the 5 mg vial
- β Swirl gently; do not shake
- β Store reconstituted peptide at 2-8°C and use within 30 days
The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL (1670-2500 mcg/mL). For precise dosing, researchers should calculate based on desired mcg per injection volume.
Typical Research Parameters
In animal models, Sermorelin is often administered at dosages ranging from 100-500 mcg per injection. Due to its short half-life, multiple daily administrations are common in prolonged studies. Subcutaneous injection is the standard route for systemic absorption research.
- β Subcutaneous injection: 100-500 mcg once or twice daily
- β Research models: Rodent dosing typically scaled by body weight
- β Study duration: 4-8 weeks for chronic GH elevation studies
Combination Research
Sermorelin is frequently studied alongside GHRP compounds like Ipamorelin or GHRP-2 to evaluate synergistic effects on GH release. This combination can produce amplified GH pulses compared to either peptide alone. For stacking protocols, Ipamorelin 5 mg can be reconstituted and administered concurrently.
Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.
What to Avoid During Research
- β Do not use if the lyophilized cake appears discolored or collapsed
- β Avoid administration with high-fat meals in oral absorption studies
- β Do not mix with strong acidic or basic solutions
- β Avoid repeated freeze-thaw cycles after reconstitution
Shipping & Product Authenticity
USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Kalpa Pharmaceuticals distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- β Orders are processed after payment confirmation
- β USA Domestic shipping is typically faster when local stock is selected
- β International orders include tracking, though update frequency may vary by destination
- β Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Kalpa Pharmaceuticals presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage Guidelines for Lyophilized Peptides
Store Kalpa Pharmaceuticals Sermorelin 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.
After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.
Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.
Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Kalpa Pharmaceuticals Sermorelin 5 mg used for in research?
Sermorelin is studied as a GHRH analog that stimulates endogenous growth hormone release via direct action on pituitary somatotrophs. Research applications include GH pulse regulation, hypothalamic-pituitary axis studies, and metabolic investigations in animal models.
How is Kalpa Pharmaceuticals Sermorelin typically reconstituted?
Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.
What is the typical research dosage for Sermorelin?
In animal studies, dosages often range from 100-500 mcg per injection, administered once or twice daily. Dosing should be scaled appropriately for the research model and study objectives.
Can Sermorelin be stacked with other peptides?
Yes. Sermorelin is commonly studied alongside GHRP compounds such as Ipamorelin or GHRP-2 to evaluate synergistic effects on GH pulsatility and release patterns.
Is Kalpa Pharmaceuticals Sermorelin tested for purity?
Third-party COA testing is currently pending. Kalpa Pharmaceuticals is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.
No reviews found
Please log in to write Sermorelin 5 mg review.