Peptide Hubs
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
You will save $16.00
Sermorelin 5 mg
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
$24.00
$40.00
Shipping Location :
International
U.S. Domestic
Buy Sermorelin 5 mg from Peptide Hubs
Peptide Hubs Sermorelin 5 mg offers a research-grade growth hormone-releasing hormone (GHRH) analog, designed to stimulate the natural production of growth hormone (GH). Each 2 mL vial contains 5 mg of Sermorelin, manufactured to meet strict research quality standards.
What is Sermorelin?
Sermorelin is a synthetic peptide consisting of the first 29 amino acids of human growth hormone-releasing hormone (GHRH). It stimulates the pituitary gland to release natural growth hormone, making it a valuable tool for research in anti-aging, muscle growth, and recovery enhancement [Clinical Study].
Key Benefits of Peptide Hubs Sermorelin
- Stimulates natural growth hormone production
- Promotes muscle growth, fat loss, and improved recovery
- Supports better sleep quality and energy levels
- May contribute to anti-aging and rejuvenation research
Technical Details
Peptide Type
Synthetic GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂
Peptide Length
29 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NH₂)
Structural Origin
Human GHRH Residues 1–29
Molecular Formula
C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight
3357.9 g/mol
CAS Number
86168-78-7
PubChem CID
16129608
Receptor Target
GHRH Receptor (GHRHR)
Signaling Pathway
GHRHR / Growth Hormone Axis
Dosage & Usage Guidelines
Research protocols commonly involve subcutaneous administration of 100–300 mcg daily, often administered before sleep to mimic natural GH secretion patterns. Longer cycles are typical (e.g., 3–6 months). Professional supervision is recommended for all peptide research.
Other Peptide Hubs Products to Explore
Enhance your growth hormone research stack by combining Sermorelin with CJC-1295 DAC. Explore additional premium-grade research peptides in the Peptide Hubs USA section.
Batch-Tested & Verified Lab Results
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Sermorelin used for?
Sermorelin is used in research to stimulate natural growth hormone production, supporting muscle growth, fat loss, recovery, and anti-aging effects.
How do you dose Sermorelin 5 mg?
Research protocols typically involve 100–300 mcg administered subcutaneously daily, usually before sleep to align with natural growth hormone secretion rhythms.
Is Sermorelin safe to use?
Sermorelin has shown a favorable safety profile in studies, with minimal side effects reported. Professional supervision is recommended during peptide research use.
Where can I buy authentic Peptide Hubs Sermorelin?
Authentic Sermorelin 5 mg is available in our Peptide Hubs USA section, offering premium research-grade peptides.
Related Offers
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
$22.80
$38.00
Lab Tested
Domestic & International
NEW
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance MOTS-c Mitochondrial-derived peptide
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Mitochondrial peptide
Peptide Length 16 amino acids
Human Half-Life Not established
Research Pathway AMPK signaling Metabolic research
$40.80
$68.00
Lab Tested
Domestic & International
NEW
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance GHK-Cu Copper tripeptide-1
Strength 50 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Copper-binding peptide
Peptide Sequence Gly-His-Lys Tripeptide
Copper Complex Cu2+
Human Half-Life Not established
$27.00
$45.00
Lab Tested
Shipped International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance Cagrilintide Acetate Long-acting amylin analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Amylin receptor agonist
Receptor Targets AMY1 / AMY2 / AMY3 Also binds calcitonin receptor
Terminal Half-Life ~7.5 days
Development Status Investigational
$54.00
$90.00