Peptide Hubs
Latest laboratory result 12.27 mg/vial January 12, 2026 · 122.70% of 10 mg label claim · Batch #GACAG12 View
You will save $36.00
Cagrilintide 10 mg
Product Details Peptide Hubs
Active Substance Cagrilintide Acetate Long-acting amylin analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Amylin receptor agonist
Receptor Targets AMY1 / AMY2 / AMY3 Also binds calcitonin receptor
Terminal Half-Life ~7.5 days
Development Status Investigational
$54.00
$90.00
Shipping Location :
International
U.S. Domestic
Buy Cagrilintide 10 mg from Peptide Hubs
Peptide Hubs Cagrilintide 10 mg provides a pharmaceutical-grade amylin analogue designed for appetite regulation and weight management research. Each 2 mL vial contains 10 mg of Cagrilintide, produced under strict quality standards to ensure high purity and consistent results.
What is Cagrilintide?
Cagrilintide is a long-acting amylin receptor agonist that helps regulate appetite, enhance satiety, and support significant weight loss. It mimics the action of the natural amylin hormone, often working synergistically with GLP-1 receptor agonists [Clinical Study].
Key Benefits of Peptide Hubs Cagrilintide
- Reduces appetite and caloric intake
- Enhances feelings of fullness (satiety)
- Supports sustainable weight loss
- May complement GLP-1 agonist therapies like Semaglutide
Technical Details
Peptide Type
Long-Acting Amylin Analogue
Peptide Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Peptide Length
38 Amino-Acid Residues
Structural Features
Lipidated & Disulfide-Cyclized
Molecular Formula
C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight
4409 g/mol
CAS Number
1415456-99-3
PubChem CID
171397054
Receptor Class
Calcitonin-Family Receptors
Development Status
Investigational
Dosage & Usage Guidelines
Research protocols suggest starting with low doses (e.g., 0.3–1.8 mg once weekly) and adjusting upward based on tolerance and research goals. Subcutaneous injection is the common administration route. Always conduct peptide research under professional supervision.
Other Peptide Hubs Products to Explore
Consider stacking Cagrilintide with Semaglutide by Peptide Hubs for enhanced metabolic and appetite control research. Discover more premium peptides in our Peptide Hubs USA catalog.
Batch-Tested & Verified Lab Results
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Cagrilintide used for?
Cagrilintide is used in research for appetite regulation, enhancing satiety, and supporting sustainable weight loss through amylin receptor activation.
How do you dose Cagrilintide 10 mg?
Research protocols typically suggest weekly subcutaneous injections, starting with 0.3–1.8 mg, with dose adjustments based on study design and subject response.
Is Cagrilintide safe to use?
Cagrilintide has shown a favorable safety profile in clinical studies. Common side effects include mild nausea or appetite suppression. Research should be supervised by healthcare professionals.
Where can I buy authentic Peptide Hubs Cagrilintide?
You can buy authentic Cagrilintide 10 mg from our Peptide Hubs USA section, offering premium-quality research peptides.
Related Offers
Lab Tested
Shipped International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance Semax ACTH(4–7)-Pro-Gly-Pro
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide ACTH-derived analogue
Peptide Length 7 amino acids MEHFPGP
Human Half-Life Not established
Research Focus Neuroprotection & cognition
$42.00
$70.00
Lab Tested
Domestic & International
NEW
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance GHK-Cu Copper tripeptide-1
Strength 50 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Copper-binding peptide
Peptide Sequence Gly-His-Lys Tripeptide
Copper Complex Cu2+
Human Half-Life Not established
$27.00
$45.00
Lab Tested
NEW
Shipped International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance PE-22-28 Spadin-derived peptide
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide Spadin-derived analogue
Peptide Length 7 amino acids GVSWGLR
Human Half-Life Not established
Primary Target TREK-1 K2P potassium channel
$27.00
$45.00