TB-500 2 mg – Regenerative Healing Peptide by Peptide Hubs
Thymosin Beta-4 (TB-500) is a naturally occurring peptide found in almost all human cells, especially platelets and white blood cells. Peptide Hubs offers a 2 mg/vial (2 mL) format specifically formulated for laboratory research investigating tissue repair, cellular migration, inflammation modulation, and muscle recovery. TB-500 is a synthetic version designed for greater stability and targeted performance in regenerative science.
What Is TB-500?
TB-500 mimics the biological actions of thymosin beta-4, a protein critical in cellular healing and immune response. It has gained popularity in preclinical research for its ability to accelerate healing in soft tissues, muscles, ligaments, and tendons. According to studies published on PubMed, TB-500 enhances actin polymerization, a key process in wound healing and tissue repair.
Key Benefits in Research Applications
- Promotes cellular migration and repair processes
- Improves healing of muscle, ligament, and tendon tissue
- May support angiogenesis and vascularization
- Exhibits anti-inflammatory properties in damaged tissue
- Enhances recovery in performance-related injury models
Technical Details
Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight
4963.4 g/mol
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ · Residues 17–22
Dosage & Usage Guidelines
In preclinical models, TB-500 is typically used at doses ranging from 2 mg to 6 mg per week, divided into multiple administrations. Administration routes include subcutaneous or intramuscular injection, and cycles may span 2–6 weeks depending on the objective of the study.
This 2 mg dosage option is ideal for shorter-term testing, targeted applications, or dose titration studies.
Combining TB-500 with Other Peptides
To support synergistic tissue regeneration, TB-500 is often stacked with complementary peptides such as:
- BPC-157 – enhances gut, tendon, and joint healing
- SS-31 – supports mitochondrial recovery in injury recovery models
- Thymosin Alpha-1 – modulates immune system responses
- Ipamorelin – boosts growth hormone secretion for improved recovery
- Melanotan 2 – used in skin recovery and inflammation-related research
Safety Profile
TB-500 is non-hormonal and generally well-tolerated in experimental settings. No hepatotoxicity or cardiovascular strain has been reported in available animal studies. Its mechanism is not androgenic, and it does not interfere with hormonal regulation. Mild injection site irritation may occur depending on volume, dilution, or frequency of administration.
Fast Domestic Shipping Across the USA
All Peptide Hubs products, including TB-500 2 mg, are available for USA domestic shipping. Orders are packaged discreetly and shipped promptly. This peptide is intended for research purposes only. For longer studies or higher dose protocols, consider combining with GHK-Cu or AOD 9604 to support broader recovery applications.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is TB-500 used for in research?
TB-500 is used in research studies for wound healing, muscle regeneration, and reducing inflammation in soft tissue injury models.
How does TB-500 work biologically?
It promotes actin polymerization, a process crucial to cell movement and regeneration, especially during healing or inflammation.
Can TB-500 be combined with other peptides?
Yes, it's commonly stacked with BPC-157, Thymosin Alpha-1, or SS-31 for more comprehensive regenerative or immune-based research.
Is TB-500 approved for human use?
No, TB-500 is not FDA-approved and is intended for laboratory research only. It is not for human or veterinary use.
No reviews found
Please log in to write TB-500 2 mg review.