TB-500 2 mg
Peptide Hubs

TB-500 2 mg

Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Full-length Tβ4 peptide
Strength 2 mg per vial
Package 1 × 2 mL vial 2 mg labeled content
Form Lyophilized powder
Research Class Actin-regulatory peptide Beta-thymosin family
Peptide Length 43 amino acids Full-length Thymosin β4
Primary Target G-actin Actin sequestration & cytoskeletal regulation
Research Area Tissue repair & cell migration Angiogenesis and regenerative research models
Shipping Location :
International
U.S. Domestic
Out of stock

TB-500 2 mg – Regenerative Healing Peptide by Peptide Hubs

Thymosin Beta-4 (TB-500) is a naturally occurring peptide found in almost all human cells, especially platelets and white blood cells. Peptide Hubs offers a 2 mg/vial (2 mL) format specifically formulated for laboratory research investigating tissue repair, cellular migration, inflammation modulation, and muscle recovery. TB-500 is a synthetic version designed for greater stability and targeted performance in regenerative science.

What Is TB-500?

TB-500 mimics the biological actions of thymosin beta-4, a protein critical in cellular healing and immune response. It has gained popularity in preclinical research for its ability to accelerate healing in soft tissues, muscles, ligaments, and tendons. According to studies published on PubMed, TB-500 enhances actin polymerization, a key process in wound healing and tissue repair.

Key Benefits in Research Applications

  • Promotes cellular migration and repair processes
  • Improves healing of muscle, ligament, and tendon tissue
  • May support angiogenesis and vascularization
  • Exhibits anti-inflammatory properties in damaged tissue
  • Enhances recovery in performance-related injury models

Technical Details

Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight
4963.4 g/mol
CAS Number
77591-33-4
PubChem CID
16132379
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ · Residues 17–22

Dosage & Usage Guidelines

In preclinical models, TB-500 is typically used at doses ranging from 2 mg to 6 mg per week, divided into multiple administrations. Administration routes include subcutaneous or intramuscular injection, and cycles may span 2–6 weeks depending on the objective of the study.

This 2 mg dosage option is ideal for shorter-term testing, targeted applications, or dose titration studies.

Combining TB-500 with Other Peptides

To support synergistic tissue regeneration, TB-500 is often stacked with complementary peptides such as:

  • BPC-157 – enhances gut, tendon, and joint healing
  • SS-31 – supports mitochondrial recovery in injury recovery models
  • Thymosin Alpha-1 – modulates immune system responses
  • Ipamorelin – boosts growth hormone secretion for improved recovery
  • Melanotan 2 – used in skin recovery and inflammation-related research

Safety Profile

TB-500 is non-hormonal and generally well-tolerated in experimental settings. No hepatotoxicity or cardiovascular strain has been reported in available animal studies. Its mechanism is not androgenic, and it does not interfere with hormonal regulation. Mild injection site irritation may occur depending on volume, dilution, or frequency of administration.

Fast Domestic Shipping Across the USA

All Peptide Hubs products, including TB-500 2 mg, are available for USA domestic shipping. Orders are packaged discreetly and shipped promptly. This peptide is intended for research purposes only. For longer studies or higher dose protocols, consider combining with GHK-Cu or AOD 9604 to support broader recovery applications.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • ✔ Orders are processed after payment confirmation
  • ✔ USA Domestic shipping is typically faster when local stock is selected
  • ✔ International orders include tracking, though update frequency may vary by destination
  • ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is TB-500 used for in research?

TB-500 is used in research studies for wound healing, muscle regeneration, and reducing inflammation in soft tissue injury models.

How does TB-500 work biologically?

It promotes actin polymerization, a process crucial to cell movement and regeneration, especially during healing or inflammation.

Can TB-500 be combined with other peptides?

Yes, it's commonly stacked with BPC-157, Thymosin Alpha-1, or SS-31 for more comprehensive regenerative or immune-based research.

Is TB-500 approved for human use?

No, TB-500 is not FDA-approved and is intended for laboratory research only. It is not for human or veterinary use.

No reviews found

Please log in to write TB-500 2 mg review.

Related Offers
Lab Tested
Domestic & International
-40% OFF
Ipamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Ipamorelin
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GH secretagogue
Peptide Length 5 amino acids Pentapeptide
Terminal Half-Life ~2 hours
Primary Target GHS-R Ghrelin receptor pathway
Latest laboratory result 4.65 mg/vial January 12, 2026 · 93.00% of 5 mg label claim · Batch #GAIPA12 View
$26.40 $44.00
You will save $17.60
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
$24.00 $40.00
You will save $16.00
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg/BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mg
BPC-157Synthetic pentadecapeptide
5 mg
Total Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
Latest laboratory result 5.85 mg / 5.97 mg January 1, 2026 · 117.00% / 119.40% of label claim · Batch #GATBBPC12 View
$45.00 $75.00
You will save $30.00
Lab Tested
Domestic & International
-40% OFF
BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
Latest laboratory result 5.17 mg/vial October 1, 2025 · 103.40% of 5 mg label claim · Batch #BPCGA8 View
$22.80 $38.00
You will save $15.20
Lab Tested
Domestic & International
-40% OFF
Melanotan 2 10 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Melanotan II MT-II
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Melanocortin analogue Synthetic cyclic peptide
Peptide Length 7 amino acids Cyclic heptapeptide
Human Half-Life Not established
Primary Targets Melanocortin receptors Nonselective agonist
Latest laboratory result 10.45 mg/vial April 22, 2025 · 104.50% of 10 mg label claim View
$26.40 $44.00
You will save $17.60
Coming Soon!
Tesamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Tesamorelin GHRH / GRF analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes Formulation dependent
Primary Target GHRH receptor Pituitary GH axis
Out of stock
Lab Tested
Shipped International
-40% OFF
Sermorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
$24.00 $40.00
You will save $16.00
Lab Tested
Shipped International
-40% OFF
Semax 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Semax ACTH(4–7)-Pro-Gly-Pro
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide ACTH-derived analogue
Peptide Length 7 amino acids MEHFPGP
Human Half-Life Not established
Research Focus Neuroprotection & cognition
Latest laboratory result 11.27 mg/vial January 12, 2026 · 225.40% of 5 mg label claim · Batch #GASEMA12 View
$42.00 $70.00
You will save $28.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: