Peptide Hubs
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
You will save $16.00
TB 500 5 mg
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
$24.00
$40.00
Shipping Location :
International
U.S. Domestic
Buy TB 500 5 mg from Peptide Hubs
Peptide Hubs TB 500 5 mg delivers high-purity Thymosin Beta-4 peptide for advanced tissue regeneration, injury recovery, and performance enhancement. Each 2 mL vial contains 5 mg of lab-tested TB-500, produced under strict quality controls to ensure potency and consistency.
What is TB-500?
TB-500 is a synthetic version of a naturally occurring peptide, Thymosin Beta-4, found in the human body. It plays a critical role in healing, cellular repair, and promoting angiogenesis (formation of new blood vessels) [Clinical Study].
Key Benefits of Peptide Hubs TB 500
- Accelerates healing of muscles, tendons, and ligaments
- Promotes angiogenesis and tissue regeneration
- Enhances flexibility and reduces inflammation
- Supports recovery after intense training or injury
Technical Details
Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight
4963.4 g/mol
CAS Number
77591-33-4
PubChem CID
16132379
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ · Residues 17–22
Dosage & Usage Guidelines
Research protocols commonly suggest administering 2–2.5 mg twice weekly during an initial loading phase (4–6 weeks), followed by a maintenance dose of 2–4 mg monthly. Subcutaneous or intramuscular injections are typically used. Consultation with healthcare providers is recommended.
Other Peptide Hubs Products to Explore
For superior recovery protocols, consider stacking TB 500 with BPC 157 by Peptide Hubs. Explore the full line of advanced peptides in the Peptide Hubs USA section.
Why Choose Peptide Hubs?
Peptide Hubs specializes in lab-tested peptides formulated with research precision. Commitment to purity, effectiveness, and safety ensures a premium product experience for professional and research purposes.
Batch-Tested & Verified Lab Results
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Related Offers
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mgBPC-157Synthetic pentadecapeptide
5 mgTotal Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
$45.00
$75.00
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
$22.80
$38.00
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance Bremelanotide PT-141
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class Melanocortin agonist
Peptide Length 7 amino acids Cyclic heptapeptide
Terminal Half-Life ~2.7 hours Subcutaneous
Primary Targets MC1R / MC4R Melanocortin receptors
$24.00
$40.00