Mobile Menu
PNC-27 5 mg
Peptide Hubs

PNC-27 5 mg

Product Details Peptide Hubs
Active Substance PNC-27 Anti-cancer research peptide
Strength 5 mg per vial
Package 1 vial 2 mL lyophilized powder
Form Lyophilized Powder
Vial Size 2 mL
Reconstitution Bacteriostatic water required
Length 32 amino acids
Primary Research Cancer cell necrosis
Shipping Location :
International
U.S. Domestic
Out of stock
  • Overview
  • Details
  • Dosage & Usage
  • Shipping
  • Storage
  • FAQ
  • Reviews

PNC-27 5 mg – Anti-Cancer Research Peptide by Peptide Hubs

PNC-27 is a synthetic peptide composed of a p53-derived sequence linked to a membrane residency domain. It has been extensively studied in preclinical research for its highly selective cytotoxic effects on cancer cells without affecting healthy tissue. Offered by Peptide Hubs in a 5 mg/vial formulation (2 mL vial), PNC-27 is strictly intended for research use and is not approved for human consumption or therapeutic applications.

What is PNC-27?

PNC-27 is engineered to mimic a segment of the p53 tumor suppressor protein, combined with a membrane translocation sequence. This design enables it to bind to HDM-2 (Human Double Minute-2), a protein overexpressed in many cancer types, forming pores in cancer cell membranes and causing selective lysis. Research has shown that it targets malignant cells while sparing healthy ones, making it a fascinating subject in the field of experimental oncology.

As outlined in this PubMed-indexed study, PNC-27 has demonstrated promising results in vitro and in murine models by inducing necrosis of tumor cells through membrane disruption. While human studies are lacking, its tumor-specific affinity continues to fuel interest in labs studying novel anti-cancer pathways.

Mechanism of Action

PNC-27 works by targeting the HDM-2 receptor, which is upregulated in a variety of tumor types. Upon binding, it integrates into the cell membrane and initiates pore formation, ultimately leading to necrosis. This action is distinctly different from traditional chemotherapeutic agents, which affect both healthy and cancerous cells indiscriminately.

Technical Details

Peptide Type
Chimeric p53-Derived Peptide
Peptide Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Peptide Length
32 Amino-Acid Residues
Terminal Form
H-PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-OH
p53-Derived Domain
Human p53 Residues 12–26
Leader Domain
17-Residue Membrane Residency Peptide (MRP)
Molecular Formula
C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight
4032 g/mol
CAS Number
1159861-00-3
PubChem CID
16201774
Research Target
Membrane-Associated HDM-2 / MDM-2
Research Status
Experimental / Preclinical

Dosage & Usage Guidelines

In experimental setups, PNC-27 is typically administered at dosages ranging from 2 mg to 5 mg per week. It is often reconstituted with bacteriostatic water and delivered via intratumoral or systemic routes in research animals. It is not for human use and is labeled accordingly for laboratory settings only.

Stacking for Advanced Research Models

Researchers exploring synergistic peptide protocols may consider combining PNC-27 with compounds such as:

  • Thymosin Alpha-1 – for immune modulation in tumor models
  • Ipamorelin – for GH axis support in long-term research
  • Melanotan 2 – being studied for pigmentation and photoprotection in skin cancer models
  • CJC-1295 no DAC – a GH secretagogue for metabolic cofactor studies

Potential Side Effects (Observed in Research Models)

While no systemic toxicity has been noted in preclinical data, researchers have reported local reactions at injection sites in animal studies. Proper lab protocol and biosafety handling are essential. No known hepatotoxicity or cardiovascular strain has been reported in published literature to date.

USA Domestic Delivery & Research Use Disclaimer

Peptide Hubs ensures quick and discreet USA domestic shipping of PNC-27 5 mg. This product is for licensed laboratories, research professionals, and educational institutions. For alternative therapeutic peptides, explore our catalog which includes BPC-157 and GHK-Cu.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • ✔ Orders are processed after payment confirmation
  • ✔ USA Domestic shipping is typically faster when local stock is selected
  • ✔ International orders include tracking, though update frequency may vary by destination
  • ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

Is PNC-27 safe for human use?

No, PNC-27 is strictly for research purposes and not approved for human use by any regulatory agency.

What is the main application of PNC-27 in research?

It is primarily studied for its selective cytotoxic effects on cancer cells, particularly those overexpressing HDM-2 receptors.

Does PNC-27 cause harm to healthy cells?

Current preclinical data suggest PNC-27 selectively targets cancer cells, leaving healthy tissue largely unaffected.

How should PNC-27 be stored?

It should be stored in a cool, dry place. Once reconstituted, it should be refrigerated and used within a few days according to lab protocols.

No reviews found

Please log in to write PNC-27 5 mg review.

Related Offers
Lab Tested
Domestic & International
-40% OFF
Ipamorelin 5 mg
Peptide Hubs
Ipamorelin 5 mg
Product Details Peptide Hubs
Active Substance Ipamorelin
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GH secretagogue
Peptide Length 5 amino acids Pentapeptide
Terminal Half-Life ~2 hours
Primary Target GHS-R Ghrelin receptor pathway
Latest laboratory result 4.65 mg/vial January 12, 2026 · 93.00% of 5 mg label claim · Batch #GAIPA12 View
$26.40 $44.00
You will save $17.60
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg
Peptide Hubs
TB 500 5 mg
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
$24.00 $40.00
You will save $16.00
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg/BPC 157 5 mg
Peptide Hubs
TB 500 5 mg/BPC 157 5 mg
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mg
BPC-157Synthetic pentadecapeptide
5 mg
Total Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
Latest laboratory result 5.85 mg / 5.97 mg January 1, 2026 · 117.00% / 119.40% of label claim · Batch #GATBBPC12 View
$45.00 $75.00
You will save $30.00
Lab Tested
Domestic & International
-40% OFF
BPC 157 5 mg
Peptide Hubs
BPC 157 5 mg
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
Latest laboratory result 5.17 mg/vial October 1, 2025 · 103.40% of 5 mg label claim · Batch #BPCGA8 View
$22.80 $38.00
You will save $15.20
Lab Tested
Domestic & International
-40% OFF
Melanotan 2 10 mg
Peptide Hubs
Melanotan 2 10 mg
Product Details Peptide Hubs
Active Substance Melanotan II MT-II
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Melanocortin analogue Synthetic cyclic peptide
Peptide Length 7 amino acids Cyclic heptapeptide
Human Half-Life Not established
Primary Targets Melanocortin receptors Nonselective agonist
Latest laboratory result 10.45 mg/vial April 22, 2025 · 104.50% of 10 mg label claim View
$26.40 $44.00
You will save $17.60
Coming Soon!
Tesamorelin 5 mg
Peptide Hubs
Tesamorelin 5 mg
Product Details Peptide Hubs
Active Substance Tesamorelin GHRH / GRF analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes Formulation dependent
Primary Target GHRH receptor Pituitary GH axis
Out of stock
Lab Tested
Shipped International
-40% OFF
Sermorelin 5 mg
Peptide Hubs
Sermorelin 5 mg
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
$24.00 $40.00
You will save $16.00
Lab Tested
Shipped International
-40% OFF
Semax 5 mg
Peptide Hubs
Semax 5 mg
Product Details Peptide Hubs
Active Substance Semax ACTH(4–7)-Pro-Gly-Pro
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide ACTH-derived analogue
Peptide Length 7 amino acids MEHFPGP
Human Half-Life Not established
Research Focus Neuroprotection & cognition
Latest laboratory result 11.27 mg/vial January 12, 2026 · 225.40% of 5 mg label claim · Batch #GASEMA12 View
$42.00 $70.00
You will save $28.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost:

Dragon Pharma

Shop authentic products with USA and international warehouse options, current lab reports and verified product information.

Lab Reports USA & International
Crypto Accepted
BTC BCH LTC ETH USDT

Shop

Information

Policies

Product information provided on this website is for informational purposes only and is not intended to replace professional medical advice, diagnosis or treatment. Consult a qualified healthcare professional before using products that may affect your health.

Products and statements presented on this website have not been evaluated by the U.S. Food and Drug Administration unless specifically stated otherwise. Customers are responsible for complying with applicable laws and age requirements in their jurisdiction.

© 2000 – 2026 Dragon Pharma. All rights reserved.
Privacy Terms
Shipping Update: Intl. delays Sep 18 – Oct 8 USA shipping normally