Peptide Hubs

LL-37 5 mg

Product Details Peptide Hubs

Active Substance LL-37 Human cathelicidin antimicrobial peptide

Strength 5 mg per vial

Package 1 vial 2 mL lyophilized powder

Form Lyophilized Powder

Vial Size 2 mL

Reconstitution Bacteriostatic water required

Length 37 amino acids

Primary Research Antimicrobial & immune modulation

Shipping Location :

International

U.S. Domestic

Out of stock

LL-37 5 mg – Peptide Hubs

LL-37 is a naturally occurring antimicrobial peptide (AMP) that plays a vital role in the human innate immune system. As the only known human cathelicidin peptide, LL-37 is involved in bacterial, viral, and fungal defense as well as in tissue healing and inflammation modulation. Peptide Hubs provides high-purity LL-37 in a 5 mg lyophilized vial for use in immune, dermatological, and regenerative research.

Mechanism of Action

LL-37 acts by disrupting the membranes of pathogens through electrostatic interactions, leading to bacterial cell lysis. Beyond antimicrobial activity, LL-37 also influences chemotaxis, angiogenesis, and epithelial cell proliferation, making it relevant in wound healing and immune surveillance models. For more information, see this NIH article on LL-37 functions in immunity.

Research Applications

Broad-spectrum antimicrobial activity studies
Skin repair and chronic wound healing models
Respiratory epithelial defense research (e.g., sinusitis, lung injury)
Modulation of inflammatory cytokines and immune response

LL-37 is often co-researched with GHK Basic for epithelial and collagen regeneration, or Chonluten for respiratory inflammation studies. Some researchers explore combined protocols with L-Glutathione for oxidative defense, or B7-33 for tissue remodeling in fibrotic conditions.

Technical Details

Peptide Type

Human Cathelicidin Host-Defense Peptide

Peptide Sequence

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Peptide Length

37 Amino-Acid Residues

Terminal Form

H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH

Molecular Formula

C₂₀₅H₃₄₀N₆₀O₅₃

Molecular Weight

4493 g/mol

CAS Number

154947-66-7

PubChem CID

16198951

Peptide Family

Cathelicidin Antimicrobial Peptide

Structural Profile

Cationic Amphipathic Peptide

Dosage & Usage Guidelines

Dosage: 100–500 mcg daily depending on study
Administration: Subcutaneous or intradermal injection
Cycle Duration: 1–4 weeks in immune or tissue repair models

Stacking Recommendations

DSIP – for immune support during recovery and anti-inflammatory balance
FOX04-DRI – in aging-related immunomodulatory pathways
Cardiogen – for vascular healing under oxidative stress models
Semaglutide – for studies involving immune-metabolic regulation

Safety & Legal Status

LL-37 is a synthetic peptide intended strictly for research use only and is not FDA-approved. It shows no toxicity, does not aromatize, and has no hormonal interaction. It is well tolerated in skin, immune, and epithelial models. For active trials and data, refer to ClinicalTrials.gov.

Shipping & Product Authenticity

USA Domestic

4–5 business days

International

13–15 business days

Order Processing

24–48 business hours

Tracking

Tracking number provided

Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

✔ Orders are processed after payment confirmation
✔ USA Domestic shipping is typically faster when local stock is selected
✔ International orders include tracking, though update frequency may vary by destination
✔ Multiple warehouses may result in separate shipments when applicable

Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.

Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is LL-37 used for in research?

LL-37 is researched for its antimicrobial properties, wound healing support, and immune system regulation in epithelial and inflammatory conditions.

Is LL-37 effective against viruses and bacteria?

Yes. LL-37 exhibits activity against bacteria, viruses, and fungi by disrupting cell membranes and enhancing immune signaling.

Can LL-37 be used in wound healing studies?

Yes. LL-37 promotes angiogenesis, epithelial cell migration, and immune modulation, making it useful in skin regeneration models.

Is LL-37 FDA-approved?

No. LL-37 is not FDA-approved and is sold for research purposes only in laboratory or preclinical settings.

No reviews found

Please log in to write LL-37 5 mg review.

Related Offers

Lab Tested

Domestic & International

-40% OFF

Peptide Hubs

Ipamorelin 5 mg

Product Details Peptide Hubs

Active Substance Ipamorelin

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class GH secretagogue

Peptide Length 5 amino acids Pentapeptide

Terminal Half-Life ~2 hours

Primary Target GHS-R Ghrelin receptor pathway

Latest laboratory result 4.65 mg/vial January 12, 2026 · 93.00% of 5 mg label claim · Batch #GAIPA12 View

$26.40 ~~$44.00~~

Lab Tested

Domestic & International

-40% OFF

Peptide Hubs

TB 500 5 mg

Product Details Peptide Hubs

Active Substance Thymosin Beta-4 Tβ4

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class β-Thymosin peptide

Peptide Length 43 amino acids

Human Half-Life Not established

Primary Target G-actin Actin sequestration

Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View

$24.00 ~~$40.00~~

Lab Tested

Domestic & International

-40% OFF

Peptide Hubs

TB 500 5 mg/BPC 157 5 mg

Product Details Peptide Hubs

Active Formula Per vial

Thymosin Beta-4β-Thymosin peptide

5 mg

BPC-157Synthetic pentadecapeptide

5 mg

Total Strength 10 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class Multi-peptide blend

Research Focus Tissue repair Regenerative research

Human PK Not established For combined formulation

Latest laboratory result 5.85 mg / 5.97 mg January 1, 2026 · 117.00% / 119.40% of label claim · Batch #GATBBPC12 View

$45.00 ~~$75.00~~

Lab Tested

Domestic & International

-40% OFF

Peptide Hubs

BPC 157 5 mg

Product Details Peptide Hubs

Active Substance BPC-157 Body Protection Compound 157

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class Synthetic peptide

Peptide Length 15 amino acids Pentadecapeptide

Human Half-Life Not established

Development Status Investigational

Latest laboratory result 5.17 mg/vial October 1, 2025 · 103.40% of 5 mg label claim · Batch #BPCGA8 View

$22.80 ~~$38.00~~

Lab Tested

Domestic & International

-40% OFF

Peptide Hubs

Melanotan 2 10 mg

Product Details Peptide Hubs

Active Substance Melanotan II MT-II

Strength 10 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class Melanocortin analogue Synthetic cyclic peptide

Peptide Length 7 amino acids Cyclic heptapeptide

Human Half-Life Not established

Primary Targets Melanocortin receptors Nonselective agonist

Latest laboratory result 10.45 mg/vial April 22, 2025 · 104.50% of 10 mg label claim View

$26.40 ~~$44.00~~

Coming Soon!

Peptide Hubs

Tesamorelin 5 mg

Product Details Peptide Hubs

Active Substance Tesamorelin GHRH / GRF analogue

Strength 10 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Drug Class GHRH analogue

Peptide Length 44 amino acids

SC Half-Life ~8–11 minutes Formulation dependent

Primary Target GHRH receptor Pituitary GH axis

Lab Tested

Shipped International

-40% OFF

Peptide Hubs

Sermorelin 5 mg

Product Details Peptide Hubs

Active Substance Sermorelin GHRH(1–29)-NH₂

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class GHRH analogue

Peptide Length 29 amino acids

Half-Life ~11–12 minutes

Primary Target GHRH receptor Pituitary GH axis

Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View

$24.00 ~~$40.00~~

Lab Tested

Shipped International

-40% OFF

Peptide Hubs

Semax 5 mg

Product Details Peptide Hubs

Active Substance Semax ACTH(4–7)-Pro-Gly-Pro

Strength 5 mg/vial

Vial Size 2 mL vial

Form Lyophilized powder For reconstitution

Research Class Neuropeptide ACTH-derived analogue

Peptide Length 7 amino acids MEHFPGP

Human Half-Life Not established

Research Focus Neuroprotection & cognition

Latest laboratory result 11.27 mg/vial January 12, 2026 · 225.40% of 5 mg label claim · Batch #GASEMA12 View

$42.00 ~~$70.00~~

LL-37 5 mg

LL-37 5 mg – Peptide Hubs

Mechanism of Action

Research Applications

Technical Details

Dosage & Usage Guidelines

Stacking Recommendations

Safety & Legal Status

Shipping & Product Authenticity

What to Expect

Storage

Frequently Asked Questions

No reviews found

Add to Cart - Product(s)