FOXO4-DRI 10 mg
Peptide Hubs

FOXO4-DRI 10 mg

Product Details Peptide Hubs
Active Substance FOXO4-DRI D-retro-inverso peptide
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Senolytic peptide
Peptide Design D-retro-inverso Cell-penetrating construct
Human Half-Life Not established
Research Target FOXO4 / p53 Senescent-cell research
Out of stock

FOX04-DRI 10 mg – Peptide Hubs

FOX04-DRI is a cutting-edge synthetic peptide designed to selectively induce apoptosis in senescent cells while preserving healthy tissue. By interfering with the FOXO4-p53 interaction, this peptide holds immense potential in research related to cellular aging, tissue regeneration, and age-related pathologies. Peptide Hubs offers a 10 mg lyophilized vial of FOX04-DRI, designed for stable and precise use in experimental setups.

What Is FOX04-DRI?

FOX04-DRI (FOXO4 D-Retro-Inverso) is a modified peptide sequence that mimics a portion of the natural FOXO4 protein but with reverse amino acid direction and D-amino acids for enhanced stability. It works by disrupting the binding of FOXO4 to p53, allowing senescent cells to undergo apoptosis without harming healthy cells. Its primary relevance lies in the field of senolytics—therapies aimed at removing aging or "zombie" cells. For more on the underlying science, read this NIH study on FOXO4-DRI and senescence clearance.

Technical Details

Peptide Type
D-Retro-Inverso Senolytic Peptide
Peptide Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Peptide Length
46 Amino-Acid Residues
Structural Design
D-Retro-Inverso Configuration
Molecular Formula
Cβ‚‚β‚‚β‚ˆHβ‚ƒβ‚ˆβ‚ˆNβ‚ˆβ‚†O₆₄
Molecular Weight
5358 g/mol
CAS Number
2460055-10-9
PubChem CID
167312269
Research Target
FOXO4–p53 Interaction
Development Status
Experimental / Preclinical

Dosage & Usage Guidelines

FOX04-DRI is being evaluated in a growing number of research fields, including:

  • Cellular senescence and anti-aging interventions
  • Tissue regeneration and wound healing models
  • Neurodegenerative disease research
  • Targeted cancer therapy resistance pathways

Because of its ability to clear senescent cells selectively, it has been studied alongside GHK-CU for skin and tissue rejuvenation, or BPC-157 to support musculoskeletal repair where senescence hinders recovery.

Suggested Experimental Use

  • Dosage: 5–10 mg per week in cycles of 2–4 weeks
  • Administration: Subcutaneous or intraperitoneal (based on research model)
  • Cycle Frequency: Intermittent cycling recommended to avoid systemic senescent depletion

Peptide Stacking Options

Researchers may pair FOX04-DRI with synergistic peptides to study comprehensive regeneration and immune modulation:

  • AOD 9604 – for lipolytic activity during tissue repair
  • DSIP – to monitor recovery sleep and HPA axis balance post-clearing
  • Cartalax – for cartilage/tendon regeneration in degenerative conditions
  • Chonluten – for immune resilience during age-related lung degeneration

Safety and Legality

FOX04-DRI is for **research use only**. It is not approved by the FDA for human use and should not be administered to humans or animals outside controlled laboratory environments. While early animal models suggest selective cytotoxicity toward senescent cells, researchers should implement rigorous safety and monitoring protocols when working with senolytic peptides.

To monitor regulatory updates or peer-reviewed developments on FOX04-DRI, refer to ClinicalTrials.gov.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is FOX04-DRI used for?

FOX04-DRI is studied for its ability to induce apoptosis in senescent cells, supporting research in aging, tissue regeneration, and cellular rejuvenation.

How does FOX04-DRI target senescent cells?

It blocks the FOXO4-p53 interaction in senescent cells, allowing them to undergo apoptosis without affecting healthy cells, thus clearing aging-related cellular waste.

Is FOX04-DRI legal for human use?

No, FOX04-DRI is not FDA-approved for medical use and is strictly intended for scientific research only.

Can FOX04-DRI be stacked with other peptides?

Yes, it is commonly studied with peptides like BPC-157, GHK-CU, and AOD 9604 in regenerative and anti-aging protocols to enhance cellular recovery.

No reviews found

Please log in to write FOXO4-DRI 10 mg review.

Related Offers
Lab Tested
Domestic & International
-40% OFF
Ipamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Ipamorelin
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GH secretagogue
Peptide Length 5 amino acids Pentapeptide
Terminal Half-Life ~2 hours
Primary Target GHS-R Ghrelin receptor pathway
Latest laboratory result 4.65 mg/vial January 12, 2026 · 93.00% of 5 mg label claim · Batch #GAIPA12 View
$26.40 $44.00
You will save $17.60
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
$24.00 $40.00
You will save $16.00
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg/BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mg
BPC-157Synthetic pentadecapeptide
5 mg
Total Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
Latest laboratory result 5.85 mg / 5.97 mg January 1, 2026 · 117.00% / 119.40% of label claim · Batch #GATBBPC12 View
$45.00 $75.00
You will save $30.00
Lab Tested
Domestic & International
-40% OFF
BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
Latest laboratory result 5.17 mg/vial October 1, 2025 · 103.40% of 5 mg label claim · Batch #BPCGA8 View
$22.80 $38.00
You will save $15.20
Lab Tested
Domestic & International
-40% OFF
Melanotan 2 10 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Melanotan II MT-II
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Melanocortin analogue Synthetic cyclic peptide
Peptide Length 7 amino acids Cyclic heptapeptide
Human Half-Life Not established
Primary Targets Melanocortin receptors Nonselective agonist
Latest laboratory result 10.45 mg/vial April 22, 2025 · 104.50% of 10 mg label claim View
$26.40 $44.00
You will save $17.60
Coming Soon!
Tesamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Tesamorelin GHRH / GRF analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes Formulation dependent
Primary Target GHRH receptor Pituitary GH axis
Out of stock
Lab Tested
Shipped International
-40% OFF
Sermorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
$24.00 $40.00
You will save $16.00
Lab Tested
Shipped International
-40% OFF
Semax 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Semax ACTH(4–7)-Pro-Gly-Pro
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide ACTH-derived analogue
Peptide Length 7 amino acids MEHFPGP
Human Half-Life Not established
Research Focus Neuroprotection & cognition
Latest laboratory result 11.27 mg/vial January 12, 2026 · 225.40% of 5 mg label claim · Batch #GASEMA12 View
$42.00 $70.00
You will save $28.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: