Axiolabs TB 500 5 mg – Thymosin Beta-4 for Tissue Repair Research
β High-purity lyophilized powder β 5 mg per 2 mL vial β Naturally occurring repair peptide β USA & International shipping
Axiolabs TB 500 5 mg is a synthetic version of Thymosin Beta-4, a naturally occurring peptide involved in wound healing, cell migration, and inflammation modulation. Each 2 mL vial contains 5 mg of lyophilized TB-500, ready for reconstitution for research applications involving soft tissue repair, angiogenesis, and recovery processes.
TB-500 has gained recognition in research circles for its ability to promote actin regulation, cell proliferation, and blood vessel formation. Unlike traditional growth factors, TB-500 works through multiple pathways including upregulation of matrix metalloproteinases and anti-apoptotic mechanisms. Explore similar research compounds like BPC 157 5 mg or GHK-CU 50 mg.
What Makes Axiolabs TB 500 Unique?
TB-500's primary mechanism involves binding to actin, a key structural protein in cells, which facilitates cell migration, proliferation, and differentiation. This actin-sequestering property distinguishes TB-500 from most other repair-focused peptides and underlies its effects on wound closure, scar reduction, and tissue remodeling.
For researchers investigating recovery acceleration, TB-500 is often studied alongside BPC-157 for synergistic effects on soft tissue repair. The 5 mg dosage and extended half-life make it suitable for twice-weekly administration protocols. Researchers may also combine TB-500 with BPC 157 to evaluate comprehensive tissue regeneration models.
Benefits of Axiolabs TB 500 for Research
- β Supports wound healing and tissue repair research
- β Promotes angiogenesis and cell migration studies
- β 5 mg lyophilized powder for flexible dosing
- β Suitable for subcutaneous administration research
- β Can be stacked with BPC-157 for comprehensive repair protocols
Research Grade
Axiolabs TB 500 5 mg is intended for laboratory research only. Not for human consumption or clinical use.
External research on TB-500's mechanisms can be explored via PubMed for peer-reviewed studies.
Technical Details
Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
CβββHββ
βNβ
βOββS
Molecular Weight
4963.4 g/mol
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ Β· Residues 17–22
Dosage & Usage Guidelines for Research
For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.
Reconstitution Protocol
- β Add 2-3 mL bacteriostatic water to the 5 mg vial
- β Swirl gently; do not shake
- β Store reconstituted peptide at 2-8°C and use within 30 days
The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL depending on the volume used. For precise dosing, researchers should calculate based on desired mg per injection volume.
Typical Research Parameters
In animal models, TB-500 is often administered at dosages ranging from 2.5-5 mg per week, typically divided into 2-3 injections due to its 2-3 day half-life. Subcutaneous injection is the standard route for systemic tissue repair research.
- β Subcutaneous injection: 1-2.5 mg per injection, 2-3 times weekly
- β Research models: Dosing typically scaled by body weight
- β Study duration: 2-6 weeks for tissue remodeling studies
Combination Research
TB-500 is frequently studied alongside BPC-157 for synergistic effects on soft tissue repair, wound healing, and inflammation reduction. This combination targets complementary pathways in tissue regeneration research. For stacking protocols, BPC 157 5 mg can be reconstituted and administered on an alternating schedule.
Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.
What to Avoid During Research
- β Do not use if the lyophilized cake appears discolored or collapsed
- β Avoid exposure to high heat or direct light
- β Do not mix with strong solvents or extreme pH solutions
- β Avoid repeated freeze-thaw cycles after reconstitution
Shipping & Product Authenticity
USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Axiolabs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- β Orders are processed after payment confirmation
- β USA Domestic shipping is typically faster when local stock is selected
- β International orders include tracking, though update frequency may vary by destination
- β Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Axiolabs presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage Guidelines for Lyophilized Peptides
Store Axiolabs TB 500 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.
After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.
Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.
Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Axiolabs TB 500 5 mg used for in research?
TB-500 (Thymosin Beta-4) is studied for its role in wound healing, soft tissue repair, inflammation modulation, and angiogenesis in animal models. It works through actin regulation and cell migration pathways.
How is Axiolabs TB 500 typically reconstituted?
Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.
What is the typical research dosage for TB-500?
In animal studies, dosages often range from 2.5-5 mg per week, typically divided into 2-3 injections due to the approximately 2-3 day half-life. Dosing should be scaled appropriately for the research model.
Can TB-500 be stacked with other peptides?
Yes. TB-500 is commonly studied alongside BPC-157 for synergistic effects on soft tissue repair, wound healing, and inflammation reduction. This combination targets complementary pathways in tissue regeneration research.
Is Axiolabs TB-500 tested for purity?
Third-party COA testing is currently pending. Axiolabs is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.
No reviews found
Please log in to write TB 500 5 mg review.