TB 500 5 mg
British Dragon

TB 500 5 mg

Product Details British Dragon
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Route-dependent IV studies: ~0.5–2.1 hours
Primary Interaction G-actin binding
Shipping Location :
International
U.S. Domestic
Out of stock

British Dragon TB 500 5 mg – Thymosin Beta-4 for Tissue Repair Research

βœ” High-purity lyophilized powder βœ” 5 mg per 2 mL vial βœ” Naturally occurring repair peptide βœ” USA & International shipping

British Dragon TB 500 5 mg is a synthetic version of Thymosin Beta-4, a naturally occurring peptide involved in wound healing, cell migration, and inflammation modulation. Each 2 mL vial contains 5 mg of lyophilized TB-500, ready for reconstitution for research applications involving soft tissue repair, angiogenesis, and recovery processes.

TB-500 has gained recognition in research circles for its ability to promote actin regulation, cell proliferation, and blood vessel formation. Unlike traditional growth factors, TB-500 works through multiple pathways including upregulation of matrix metalloproteinases and anti-apoptotic mechanisms. Explore similar research compounds like BPC 157 5 mg or GHK-CU 50 mg.

What Makes British Dragon TB 500 Unique?

TB-500's primary mechanism involves binding to actin, a key structural protein in cells, which facilitates cell migration, proliferation, and differentiation. This actin-sequestering property distinguishes TB-500 from most other repair-focused peptides and underlies its effects on wound closure, scar reduction, and tissue remodeling.

For researchers investigating recovery acceleration, TB-500 is often studied alongside BPC-157 for synergistic effects on soft tissue repair. The 5 mg dosage and extended half-life make it suitable for twice-weekly administration protocols. Researchers may also combine TB-500 with BPC 157 to evaluate comprehensive tissue regeneration models.

Benefits of British Dragon TB 500 for Research

  • βœ” Supports wound healing and tissue repair research
  • βœ” Promotes angiogenesis and cell migration studies
  • βœ” 5 mg lyophilized powder for flexible dosing
  • βœ” Suitable for subcutaneous administration research
  • βœ” Can be stacked with BPC-157 for comprehensive repair protocols
Research Grade

British Dragon TB 500 5 mg is intended for laboratory research only. Not for human consumption or clinical use.

External research on TB-500's mechanisms can be explored via PubMed for peer-reviewed studies.

Technical Details

Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
C₂₁₂H₃₅₀N₅₆Oβ‚‡β‚ˆS
Molecular Weight
4963.4 g/mol
CAS Number
77591-33-4
PubChem CID
16132379
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ Β· Residues 17–22

Dosage & Usage Guidelines for Research

For laboratory research use only. Not for human consumption. Reconstitution and handling must be performed by qualified personnel using sterile techniques.

Reconstitution Protocol

  • βœ” Add 2-3 mL bacteriostatic water to the 5 mg vial
  • βœ” Swirl gently; do not shake
  • βœ” Store reconstituted peptide at 2-8°C and use within 30 days

The standard reconstitution yields a concentration of approximately 1.67-2.5 mg/mL depending on the volume used. For precise dosing, researchers should calculate based on desired mg per injection volume.

Typical Research Parameters

In animal models, TB-500 is often administered at dosages ranging from 2.5-5 mg per week, typically divided into 2-3 injections due to its 2-3 day half-life. Subcutaneous injection is the standard route for systemic tissue repair research.

  • βœ” Subcutaneous injection: 1-2.5 mg per injection, 2-3 times weekly
  • βœ” Research models: Dosing typically scaled by body weight
  • βœ” Study duration: 2-6 weeks for tissue remodeling studies

Combination Research

TB-500 is frequently studied alongside BPC-157 for synergistic effects on soft tissue repair, wound healing, and inflammation reduction. This combination targets complementary pathways in tissue regeneration research. For stacking protocols, BPC 157 5 mg can be reconstituted and administered on an alternating schedule.

Note: Dosages mentioned are for research purposes only. Individual response varies in animal models. Always follow institutional animal care guidelines when conducting in vivo research.

What to Avoid During Research

  • ❌ Do not use if the lyophilized cake appears discolored or collapsed
  • ❌ Avoid exposure to high heat or direct light
  • ❌ Do not mix with strong solvents or extreme pH solutions
  • ❌ Avoid repeated freeze-thaw cycles after reconstitution

Shipping & Product Authenticity

USA Domestic
4-5 business days
International
13-15 business days
Order Processing
24-48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official British Dragon distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official British Dragon presentation, batch-linked documentation, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage Guidelines for Lyophilized Peptides

Store British Dragon TB 500 5 mg lyophilized powder in a cool, dry place away from direct light and moisture. Prior to reconstitution, the unopened vial should be kept at controlled room temperature (15-25°C) or refrigerated (2-8°C) for long-term storage. Do not freeze the lyophilized powder, as this may damage the peptide structure.

After reconstitution with bacteriostatic water, the solution must be stored at 2-8°C (refrigerator) and used within 30 days to maintain peptide integrity. Avoid repeated freeze-thaw cycles. Do not use if the solution appears cloudy or contains particulates, or if the vial seal is compromised.

Keep out of reach of children and unauthorized personnel. Follow standard laboratory safety protocols when handling peptides.

Proper storage conditions help maintain research-grade purity and consistent performance across the product's shelf life.

Frequently Asked Questions

What is British Dragon TB 500 5 mg used for in research?

TB-500 (Thymosin Beta-4) is studied for its role in wound healing, soft tissue repair, inflammation modulation, and angiogenesis in animal models. It works through actin regulation and cell migration pathways.

How is British Dragon TB 500 typically reconstituted?

Add 2-3 mL of bacteriostatic water to the 5 mg vial, swirling gently until fully dissolved. The resulting concentration will be approximately 1.67-2.5 mg/mL depending on the volume used.

What is the typical research dosage for TB-500?

In animal studies, dosages often range from 2.5-5 mg per week, typically divided into 2-3 injections due to the approximately 2-3 day half-life. Dosing should be scaled appropriately for the research model.

Can TB-500 be stacked with other peptides?

Yes. TB-500 is commonly studied alongside BPC-157 for synergistic effects on soft tissue repair, wound healing, and inflammation reduction. This combination targets complementary pathways in tissue regeneration research.

Is British Dragon TB-500 tested for purity?

Third-party COA testing is currently pending. British Dragon is committed to publishing batch-specific lab reports as soon as analytical testing is completed and verified.

No reviews found

Please log in to write TB 500 5 mg review.

Related Offers
Lab Tested
Tb 500
Stealth Labs

CLASSIFICATION: REGENERATIVE PEPTIDE
ACTIVE SUBSTANCE: THYMOSIN BETA 4
FORM: 2 ML VIAL x 10 MG (LYOPHILIZED POWDER)
ACTIVE HALF-LIFE: ~ 2–3 HOURS
DOSAGE: 2–5 MG TWICE WEEKLY (LOADING), THEN ONCE WEEKLY
ACNE: NOT REPORTED
WATER RETENTION: NOT REPORTED
HIGH BLOOD PRESSURE (HBP): UNLIKELY
HEPATOTOXICITY: NO
AROMATIZATION: NO
MANUFACTURER: STEALTH LABS
LABORATORY TESTED: VIEW LAB RESULTS
SHIPPED WITHOUT LABEL!

Out of stock
TB 500 5 mg
Axiolabs
Product Details Axiolabs
Active Substance Thymosin Beta-4 Also known as Tβ4
Strength 5 mg/vial
Package 1 × 2 mL vial 5 mg total labeled content
Form Lyophilized powder
Research Class Regenerative peptide
Peptide Type 43 amino acids
Human Half-Life Short, dose-dependent
Research Focus Tissue repair
Out of stock
Lab Tested
Domestic & International
-40% OFF
TB 500
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide
Peptide Type 43-amino-acid peptide
Human Half-Life Not established
Biological Role Actin regulation Actin-sequestering peptide
Latest laboratory result 6.15 mg March 22, 2024 · 123.00% of 5 mg label claim · Batch TBHO23 View
$27.00 $45.00
You will save $18.00
TB 500 5 mg
Kalpa Pharmaceuticals LTD, India
Product Details Kalpa Pharmaceuticals
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Route-dependent Short in IV studies
Primary Interaction G-actin binding
Out of stock
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
$24.00 $40.00
You will save $16.00
Kalpatropin HGH 200 IU
Kalpa Pharmaceuticals LTD, India
Product Details Kalpa Pharmaceuticals
Active Substance Somatropin Recombinant human growth hormone
Strength 20 IU/vial
Package 10 × 2 mL vials 200 IU total labeled content
Form Lyophilized powder For reconstitution
Drug Class Human growth hormone
Protein Length 191 amino acids
Hormone Type Recombinant hGH
Technology Recombinant DNA
Out of stock

Add to Cart - Product(s)

Close Button
Empty

Total Cost: