Dragon Pharma PNC-27 10 mg – Experimental Peptide for Cancer Cell Necrosis Research
✔ 32-amino-acid synthetic peptide ✔ Targets HDM-2 proteins on cancer cells ✔ Induces necrosis while sparing normal cells ✔ USA domestic shipping available
Dragon Pharma PNC-27 10 mg is an experimental synthetic peptide consisting of 32 amino acids that has been studied for its anti-cancer properties in laboratory settings. This peptide combines a fragment of the p53 tumor suppressor protein with a cell-penetrating sequence, creating a compound designed to specifically target cancer cells while leaving healthy cells unaffected.
Each vial contains 10 mg of lyophilized PNC-27 in a 2 mL format, requiring reconstitution with bacteriostatic water before use. The unique mechanism of PNC-27 involves targeting HDM-2 proteins on cancer cell membranes, resulting in pore formation and subsequent cell death through necrosis. For related research compounds, explore our peptides category and specifically FOXO4-DRI for studies on cellular senescence.
What Makes PNC-27 Valuable in Research?
PNC-27 represents a unique approach to cancer research through its selective targeting mechanism. By combining the p53 fragment with a cell-penetrating sequence, this peptide is designed to interact specifically with HDM-2 proteins present on cancer cell membranes. This interaction triggers pore formation, leading to rapid cell death through necrosis while demonstrating selectivity for cancer cells over normal cells.
Researchers value PNC-27 for its novel mechanism of action and its potential to provide insights into cancer cell biology. Its ability to induce necrosis specifically in cancer cells makes it a valuable tool for investigating cancer cell vulnerability and developing new therapeutic strategies. For investigators exploring other mechanisms of cellular regulation, Epitalon 50 mg offers complementary research avenues in cellular health and longevity.
Current scientific literature on PNC-27 can be accessed through the PubMed database, where researchers can review peer-reviewed studies on its biological activity and experimental applications.
Key Research Applications for Dragon Pharma PNC-27
- ✔ Investigation of cancer cell death mechanisms
- ✔ Evaluation of HDM-2 targeting and pore formation
- ✔ Research on cancer cell selectivity and normal cell sparing
- ✔ Studies of necrosis pathways in cancer models
- ✔ Preclinical models of anti-cancer activity
For Research Purposes Only
PNC-27 10 mg is intended for research use only and is not approved for human consumption. Proper handling, reconstitution, and experimental protocols are essential for reliable results. For studies on cell death mechanisms, DIHEXA 5 mg provides additional research avenues in cellular biology.
Technical Details
Peptide Type
Chimeric p53-Derived Peptide
Peptide Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Peptide Length
32 Amino-Acid Residues
Terminal Form
H-PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG-OH
p53-Derived Domain
Human p53 Residues 12–26
Leader Domain
17-Residue Membrane Residency Peptide (MRP)
Molecular Formula
C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight
4032 g/mol
Research Target
Membrane-Associated HDM-2 / MDM-2
Research Status
Experimental / Preclinical
Dosage & Usage Guidelines
For research and laboratory use only. Dragon Pharma PNC-27 10 mg is an experimental synthetic peptide. Proper reconstitution, handling, and experimental design are essential for obtaining reliable data.
Reconstitution Protocol
- ✔ Use sterile bacteriostatic water for injection
- ✔ Add appropriate volume to achieve desired concentration
- ✔ Swirl gently to dissolve – do not shake vigorously
- ✔ Store reconstituted solution at 2–8°C
Reconstitute the lyophilized powder using bacteriostatic water to a concentration suitable for your research protocol. The 10 mg format allows for flexible dosing across a range of experimental models. Always use aseptic technique during preparation to maintain peptide integrity.
Typical Research Parameters
In research settings, PNC-27 is typically administered via subcutaneous or intravenous injection in experimental models. Dosing schedules and concentrations vary widely depending on the experimental design, cell line, or animal model, and specific research objectives.
- ✔ Commonly used in cancer cell line studies
- ✔ Often combined with cell viability and apoptosis assays
- ✔ Used to investigate cancer cell membrane interactions
- ✔ Research models include various cancer cell types and xenograft studies
Factors to Consider in Research Protocols
- Specific targeting of HDM-2 requires careful dose optimization
- Reconstitution stability is limited; prepare fresh solutions for each use
- Individual variation in response may be observed across cell lines
- Storage conditions significantly impact peptide stability
Research note: PNC-27 combines a p53 tumor suppressor fragment with a cell-penetrating sequence, creating a peptide that specifically targets HDM-2 proteins on cancer cell membranes. This unique mechanism induces pore formation and necrosis, providing a targeted approach for investigating cancer cell vulnerability while sparing normal cells.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma PNC-27 10 mg used for?
PNC-27 is used in research to investigate anti-cancer mechanisms through targeted necrosis. It combines a p53 fragment with a cell-penetrating sequence to target HDM-2 proteins on cancer cell membranes, inducing pore formation and cell death while sparing normal cells.
How does PNC-27 work?
PNC-27 targets HDM-2 proteins on cancer cell membranes, creating pores that lead to rapid cell death through necrosis. Its structure combines a p53 tumor suppressor fragment with a cell-penetrating sequence for selective cancer cell targeting.
How do I reconstitute PNC-27 10 mg powder?
Reconstitute the lyophilized powder with sterile bacteriostatic water for injection. Add the appropriate volume, swirl gently until fully dissolved, and avoid vigorous shaking to preserve peptide integrity.
What is the shelf life of PNC-27 after reconstitution?
Reconstituted PNC-27 should be stored at 2–8°C and used within 14 days. Discard any unused solution after this period to ensure stability and research accuracy.
Is Dragon Pharma PNC-27 10 mg lab-tested?
Third-party laboratory testing for PNC-27 10 mg is currently pending. Batch-specific COA data will be published once analytical testing is completed and verified.
No reviews found
Please log in to write PNC-27 10 mg review.
