Dragon Pharma FOXO4-DRI 10 mg – Experimental Senolytic Peptide for Senescence Research
✔ Selective senescent cell clearance ✔ FOXO4-p53 pathway inhibitor ✔ Studied for anti-aging mechanisms ✔ USA domestic shipping available
Dragon Pharma FOXO4-DRI 10 mg is an experimental senolytic peptide designed to selectively target and eliminate senescent cells, commonly referred to as "zombie" cells. This peptide functions by blocking the interaction between the FOXO4 and p53 proteins, a mechanism that has been investigated in preclinical studies for its potential to reduce age-related markers and improve physical function.
Each vial contains 10 mg of lyophilized FOXO4-DRI in a 2 mL format, requiring reconstitution with bacteriostatic water before use. FOXO4-DRI represents a targeted research tool for investigating cellular senescence, aging processes, and potential therapeutic interventions. For related research compounds, explore our peptides category and specifically Epitalon 50 mg for complementary longevity research applications.
What Makes FOXO4-DRI Valuable in Research?
FOXO4-DRI is a rationally designed peptide that specifically disrupts the FOXO4-p53 interaction, which is critical for senescent cell survival. By interfering with this protein-protein interaction, FOXO4-DRI triggers apoptosis selectively in senescent cells while leaving healthy cells unaffected. This targeted approach has demonstrated promising results in preclinical mouse models, showing reduced senescence markers and improved physical performance.
Researchers value FOXO4-DRI for its specificity and the mechanistic insights it provides into cellular senescence pathways. Its ability to selectively clear senescent cells makes it a valuable tool for investigating the role of senescence in aging, tissue dysfunction, and age-related diseases. For investigators exploring cellular protection mechanisms, SS-31 50 mg offers complementary research avenues in mitochondrial function and cellular health.
Current scientific literature on FOXO4-DRI and senolytic research can be accessed through the PubMed database, where researchers can review peer-reviewed studies on its biological activity and experimental applications.
Key Research Applications for Dragon Pharma FOXO4-DRI
- ✔ Investigation of cellular senescence mechanisms
- ✔ Evaluation of senolytic activity in various tissue types
- ✔ Research on aging and age-related pathologies
- ✔ Studies of tissue regeneration following senescence clearance
- ✔ Preclinical models of physical function and recovery
For Research Purposes Only
FOXO4-DRI 10 mg is intended for research use only and is not approved for human consumption. Proper handling, reconstitution, and experimental protocols are essential for reliable results. For studies on regenerative peptides, BPC 157 provides additional research avenues in tissue repair mechanisms.
Technical Details
Peptide Type
D-Retro-Inverso Senolytic Peptide
Peptide Sequence
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Peptide Length
46 Amino-Acid Residues
Structural Design
D-Retro-Inverso Configuration
Molecular Formula
C₂₂₈H₃₈₈N₈₆O₆₄
Molecular Weight
5358 g/mol
Research Target
FOXO4–p53 Interaction
Development Status
Experimental / Preclinical
Dosage & Usage Guidelines
For research and laboratory use only. Dragon Pharma FOXO4-DRI 10 mg is an experimental senolytic peptide. Proper reconstitution, handling, and experimental design are essential for obtaining reliable data.
Reconstitution Protocol
- ✔ Use sterile bacteriostatic water for injection
- ✔ Add appropriate volume to achieve desired concentration
- ✔ Swirl gently to dissolve – do not shake vigorously
- ✔ Store reconstituted solution at 2–8°C
Reconstitute the lyophilized powder using bacteriostatic water to a concentration suitable for your research protocol. The 10 mg format allows for flexible dosing across a range of experimental models. Always use aseptic technique during preparation to maintain peptide integrity.
Typical Research Parameters
In research settings, FOXO4-DRI is typically administered via subcutaneous or intraperitoneal injection. Dosing schedules and concentrations vary widely depending on the experimental design, animal model, and specific research objectives.
- ✔ Commonly used in senescence clearance studies
- ✔ Often combined with tissue analysis and biomarker evaluation
- ✔ Used to investigate aging mechanisms and physical function
- ✔ Research models include aged mice and senescence-accelerated models
Factors to Consider in Research Protocols
- Specific targeting of senescent cells requires careful dose optimization
- Reconstitution stability is limited; prepare fresh solutions for each use
- Individual variation in response may be observed across subjects
- Storage conditions significantly impact peptide stability
Research note: FOXO4-DRI selectively induces apoptosis in senescent cells by disrupting the FOXO4-p53 interaction. This targeted mechanism provides a unique opportunity to investigate the contribution of cellular senescence to aging and age-related pathologies in preclinical models.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma FOXO4-DRI 10 mg used for?
FOXO4-DRI is used in research to selectively target and clear senescent cells by blocking the FOXO4-p53 interaction. It is studied for its potential to reduce markers of aging and improve physical function in preclinical models.
How does FOXO4-DRI work?
FOXO4-DRI disrupts the interaction between FOXO4 and p53 proteins, which is critical for senescent cell survival. This disruption triggers apoptosis selectively in senescent cells while leaving healthy cells unaffected.
How do I reconstitute FOXO4-DRI 10 mg powder?
Reconstitute the lyophilized powder with sterile bacteriostatic water for injection. Add the appropriate volume, swirl gently until fully dissolved, and avoid vigorous shaking to preserve peptide integrity.
What is the shelf life of FOXO4-DRI after reconstitution?
Reconstituted FOXO4-DRI should be stored at 2–8°C and used within 14 days. Discard any unused solution after this period to ensure stability and research accuracy.
Is Dragon Pharma FOXO4-DRI 10 mg lab-tested?
Third-party laboratory testing for FOXO4-DRI 10 mg is currently pending. Batch-specific COA data will be published once analytical testing is completed and verified.
No reviews found
Please log in to write FOXO4-DRI 10 mg review.
