Dragon Pharma
Latest laboratory result 6.15 mg March 22, 2024 · 123.00% of 5 mg label claim · Batch TBHO23 View
You will save $18.00
TB 500
Product Details Dragon Pharma
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide
Peptide Type 43-amino-acid peptide
Human Half-Life Not established
Biological Role Actin regulation Actin-sequestering peptide
$27.00
$45.00
Shipping Location :
International
U.S. Domestic
Trusted Dragon Pharma TB 500 Source
DragonPharma.Net offers original peptide therapies from Dragon Pharma, including high-purity TB 500 – one of the most effective recovery enhancers available.
What is TB 500?
TB-500 (Thymosin Beta-4) is a synthetic version of a naturally occurring peptide that plays a critical role in regeneration and repair. It supports cell migration, blood vessel formation, and tissue recovery. Due to its broad healing potential, TB 500 has gained strong traction among athletes and biohackers for soft tissue repair, joint health, and reducing recovery time.
To learn more about TB-500's biological function, visit this PubMed research summary.
Technical Details
Peptide Type
Endogenous Actin-Binding Peptide
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
Peptide Length
43 Amino-Acid Residues
Terminal Form
N-Terminal Acetylated Peptide
Molecular Formula
C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight
4963.4 g/mol
CAS Number
77591-33-4
PubChem CID
16132379
Primary Binding Partner
G-Actin
Biological Function
Actin Monomer Sequestration
Actin-Binding Region
LKKTETQ · Residues 17–22
Dosage & Usage Guidelines
TB-500 is administered through subcutaneous injection, often as part of a structured recovery protocol. A typical approach includes:
- Loading Phase: 4 to 6 weeks at 5–7.5 mg per week
- Maintenance Phase: 2.5–5 mg every 1–2 weeks as needed
This compound may be combined with others like BPC-157 for synergistic effects in tissue regeneration protocols, especially in tendon or ligament injuries.
Example TB 500 Cycle
Many users begin with 2 injections per week (2.5 mg each) during the first month, followed by a reduction to a weekly injection for maintenance. A full TB-500 cycle often lasts 6–8 weeks, with extended use possible based on injury type and goals.
Some users continue with low-dose TB-500 or integrate peptides like CJC-1295 DAC or GHK-CU to support long-term recovery and collagen synthesis.
Post-Cycle Considerations
Because TB-500 does not impact hormonal function, traditional PCT is not required. However, some users continue with a lower maintenance dose to sustain recovery benefits.
Possible Side Effects
TB 500 is typically well tolerated. Mild injection site irritation is the most reported issue. Other rare effects include fatigue or lightheadedness. As with any injectable compound, using proper sterile technique is essential.
Stacking & Product Pairing
TB-500 is commonly paired with BPC-157, CJC-1295 DAC, or AOD 9604 for broader support in tissue repair, inflammation control, and muscle protection. Visit our Peptides category for more recovery-supporting products.
Why Choose Dragon Pharma TB 500?
With pharmaceutical-grade quality and verified purity, Dragon Pharma's TB-500 is one of the most trusted options on the market. For those seeking optimal recovery speed and joint function support, it's a top-tier choice.
Explore more from the official Dragon Pharma source trusted by athletes and professionals alike.
Lab Testing & Batch Transparency
2024-03-22
6.15 mg
2023-09-25
6.31 mg
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma TB 500 used for?
TB 500 (Thymosin Beta-4) is used to accelerate recovery from muscle and tendon injuries, improve flexibility, and reduce inflammation. It's popular among athletes and bodybuilders for promoting tissue repair and healing support.
How do I use TB 500 for injury recovery?
TB 500 is typically injected subcutaneously 1–2 times per week. Common protocols start with 5–7.5 mg weekly for 4–6 weeks (loading phase), followed by a maintenance dose of 2.5–5 mg weekly or biweekly, depending on progress.
Do I need PCT after using TB 500?
No. TB 500 does not affect hormone production, so traditional post-cycle therapy (PCT) is not required. However, some users continue with a low maintenance dose for sustained recovery benefits.
Is TB 500 safe to use?
When used responsibly, TB 500 is considered very safe. The most common side effect is mild redness or irritation at the injection site. Always use sterile technique and consult a healthcare provider if uncertain.
Where can I buy Dragon Pharma TB 500 online?
You can buy original Dragon Pharma TB 500 5 mg vials from our store with verified lab-tested quality and secure USA delivery. Always check for authenticity when ordering peptides online.
Related Offers
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Selank Tuftsin-derived peptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide
Peptide Type Heptapeptide Thr-Lys-Pro-Arg-Pro-Gly-Pro
Human Half-Life Not established
Research Focus Neuroregulation Anxiolytic & nootropic research
$27.00
$45.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Melanotan II MT-II
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Melanocortin peptide
Peptide Type Cyclic heptapeptide Synthetic α-MSH analog
Human Half-Life Not established
Development Status Unapproved
$27.00
$45.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Semax ACTH(4–7)-PGP
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide ACTH-derived peptide
Peptide Type Heptapeptide Met-Glu-His-Phe-Pro-Gly-Pro
Peptide Half-Life Several minutes
Research Focus Neuroregulation Nootropic & neuroprotective research
$39.00
$65.00
Domestic & International
Dragon Pharma, Europe
Product Details Dragon Pharma
Product Type Bacteriostatic Water Sterile diluent
Contents Sterile Water For injection
Preservative 0.9% Benzyl Alcohol
Package 10 mL vial
Form Sterile solution
Purpose Diluent & solvent
Sterility Sterile
Preserved Yes Contains benzyl alcohol
$20.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance BPC-157 Synthetic pentadecapeptide
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Research peptide
Peptide Type Pentadecapeptide 15 amino acids
Human Half-Life Not established
Development Status Investigational
$24.00
$40.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Formula Per vial
TB-500 Thymosin β4-derived peptide
5 mgBPC-157 Synthetic pentadecapeptide
5 mgTotal Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg total labeled content
Form Lyophilized powder
Research Class Peptide blend
Peptide Profile Dual peptide TB-500 + BPC-157
Human Half-Life Not established
$48.00
$80.00
Lab Tested
Shipped USA Domestic
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Levocarnitine L-Carnitine
Strength 500 mg per vial
Package 1 × 2 mL vial 500 mg labeled content
Form Lyophilized powder
Compound Class Carnitine derivative
Biological Role Fatty-acid transport Mitochondrial energy metabolism
IV Terminal Half-Life Approximately 17.4 hours
Elimination Primarily renal
$84.00
$140.00
Lab Tested
Shipped USA Domestic
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Cagrilintide Acetate Long-acting amylin analog
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Drug Class Amylin analog
Mechanism Amylin receptor agonist
Estimated Half-Life Approximately 6.6–8.1 days
Development Status Investigational
$96.00
$160.00
December 27, 2024
My muscle stiffness has decreased, and my recovery time is faster. TB 500 gives me the support I need to thrive.