Dragon Pharma Cagrilintide Acetate – Fat Loss Support via Amylin Analog
Cagrilintide Acetate 10mg is a next-generation amylin analog developed by Dragon Pharma, designed to aid in appetite suppression, glucose regulation, and fat loss. Each 2 mL vial contains 10 mg of the active peptide, offering potent effects for athletes and physique competitors seeking advanced support during cutting phases.
What is Cagrilintide Acetate?
Cagrilintide mimics the naturally occurring hormone amylin, which plays a key role in appetite regulation and glucose control. By activating amylin receptors, it promotes satiety, reduces calorie intake, and slows gastric emptying. Bodybuilders and athletes use this compound to manage cravings, control diet adherence, and improve fat loss efficiency without compromising muscle retention.
Technical Details
Peptide Type
Long-Acting Amylin Analogue
Peptide Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Peptide Length
38 Amino-Acid Residues
Structural Features
Lipidated & Disulfide-Cyclized
Molecular Formula
CβββHβββNβ
βOβ
βSβ
Molecular Weight
4409 g/mol
Receptor Class
Calcitonin-Family Receptors
Development Status
Investigational
Dosage & Usage Guidelines
During cutting cycles, Dragon Pharma Cagrilintide is administered subcutaneously to aid in calorie control. Users typically start at a low dose of 0.3 mg per week and gradually increase to 1.2 mg per week over a 12–16 week cycle. This peptide is commonly stacked with Anavar, HGH, or Clenbuterol to accelerate fat loss while maintaining strength and lean muscle mass.
Users sourcing fat-loss stacks often trust only established platforms. As part of the trusted Dragon Pharma supplier network, our store guarantees pharmaceutical-grade peptides shipped directly to your door.
Example Cagrilintide Cycle Protocol
- Weeks 1–4: 0.3 mg per week (subcutaneous, 1–2x weekly)
- Weeks 5–12: Gradually increase to 1.2 mg/week based on tolerance
- Stack with Clenbuterol or HGH for enhanced metabolic support
Clinical studies have investigated the role of amylin analogs like Cagrilintide in appetite regulation and metabolic control, supporting its use in fat-loss and glucose management protocols. See related studies on PubMed.
Potential Side Effects
Initial side effects may include mild nausea, bloating, or appetite fluctuations—usually subsiding after a few days. Less common effects include lightheadedness or gastrointestinal discomfort. Users should avoid stacking with glucose-lowering drugs without supervision.
For most, Cagrilintide offers excellent tolerability and becomes an effective aid in long-term fat loss management when paired with diet and training consistency.
Lab Testing & Batch Transparency

Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- β Orders are processed after payment confirmation
- β USA Domestic shipping is typically faster when local stock is selected
- β International orders include tracking, though update frequency may vary by destination
- β Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Cagrilintide used for in bodybuilding?
Cagrilintide is used to reduce appetite and support fat loss during cutting phases without sacrificing muscle mass. It helps bodybuilders maintain calorie control.
Does Cagrilintide Acetate suppress testosterone?
No, it does not interfere with natural testosterone levels, making it ideal for stacking with anabolic agents during cutting cycles.
How long can I use Cagrilintide safely?
Cycles typically last 12β16 weeks, with slow titration to avoid gastrointestinal side effects. Always consult a professional for long-term use.
Cagrilintide Acetate 10 mg Reviews
Please log in to write Cagrilintide Acetate 10 mg review.
March 10, 2026
Excellent. Kills appetite but if you want to eat you can. Great for portion control. Very helpful peptide.