Cagrilintide Acetate 10 mg Cagrilintide Acetate 10 mg
Peptides

Cagrilintide Acetate 10 mg

Product Details Dragon Pharma
Active Substance Cagrilintide Acetate Long-acting amylin analog
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Drug Class Amylin analog
Mechanism Amylin receptor agonist
Estimated Half-Life Approximately 6.6–8.1 days
Development Status Investigational
Latest laboratory result 9.39 mg September 13, 2024 · 93.90% of 10 mg label claim · Batch CGDHD7 View
$96.00 $160.00
Shipping Location :
International
U.S. Domestic
You will save $64.00

Dragon Pharma Cagrilintide Acetate – Fat Loss Support via Amylin Analog

Cagrilintide Acetate 10mg is a next-generation amylin analog developed by Dragon Pharma, designed to aid in appetite suppression, glucose regulation, and fat loss. Each 2 mL vial contains 10 mg of the active peptide, offering potent effects for athletes and physique competitors seeking advanced support during cutting phases.

What is Cagrilintide Acetate?

Cagrilintide mimics the naturally occurring hormone amylin, which plays a key role in appetite regulation and glucose control. By activating amylin receptors, it promotes satiety, reduces calorie intake, and slows gastric emptying. Bodybuilders and athletes use this compound to manage cravings, control diet adherence, and improve fat loss efficiency without compromising muscle retention.

Technical Details

Peptide Type
Long-Acting Amylin Analogue
Peptide Sequence
XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Peptide Length
38 Amino-Acid Residues
Structural Features
Lipidated & Disulfide-Cyclized
Molecular Formula
C₁₉₄H₃₁₂Nβ‚…β‚„O₅₉Sβ‚‚
Molecular Weight
4409 g/mol
CAS Number
1415456-99-3
PubChem CID
171397054
Receptor Class
Calcitonin-Family Receptors
Development Status
Investigational

Dosage & Usage Guidelines

During cutting cycles, Dragon Pharma Cagrilintide is administered subcutaneously to aid in calorie control. Users typically start at a low dose of 0.3 mg per week and gradually increase to 1.2 mg per week over a 12–16 week cycle. This peptide is commonly stacked with Anavar, HGH, or Clenbuterol to accelerate fat loss while maintaining strength and lean muscle mass.

Users sourcing fat-loss stacks often trust only established platforms. As part of the trusted Dragon Pharma supplier network, our store guarantees pharmaceutical-grade peptides shipped directly to your door.

Example Cagrilintide Cycle Protocol

  • Weeks 1–4: 0.3 mg per week (subcutaneous, 1–2x weekly)
  • Weeks 5–12: Gradually increase to 1.2 mg/week based on tolerance
  • Stack with Clenbuterol or HGH for enhanced metabolic support

Clinical studies have investigated the role of amylin analogs like Cagrilintide in appetite regulation and metabolic control, supporting its use in fat-loss and glucose management protocols. See related studies on PubMed.

Potential Side Effects

Initial side effects may include mild nausea, bloating, or appetite fluctuations—usually subsiding after a few days. Less common effects include lightheadedness or gastrointestinal discomfort. Users should avoid stacking with glucose-lowering drugs without supervision.

For most, Cagrilintide offers excellent tolerability and becomes an effective aid in long-term fat loss management when paired with diet and training consistency.

Lab Testing & Batch Transparency

dragon pharma cagrilintide lab tes results 2024-09-13

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is Cagrilintide used for in bodybuilding?

Cagrilintide is used to reduce appetite and support fat loss during cutting phases without sacrificing muscle mass. It helps bodybuilders maintain calorie control.

Does Cagrilintide Acetate suppress testosterone?

No, it does not interfere with natural testosterone levels, making it ideal for stacking with anabolic agents during cutting cycles.

How long can I use Cagrilintide safely?

Cycles typically last 12–16 weeks, with slow titration to avoid gastrointestinal side effects. Always consult a professional for long-term use.

Cagrilintide Acetate 10 mg Reviews

L***y.
March 10, 2026

Excellent. Kills appetite but if you want to eat you can. Great for portion control. Very helpful peptide.

Please log in to write Cagrilintide Acetate 10 mg review.

Related Offers
Lab Tested
Domestic & International
-40% OFF
TB 500
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide
Peptide Type 43-amino-acid peptide
Human Half-Life Not established
Biological Role Actin regulation Actin-sequestering peptide
Latest laboratory result 6.15 mg March 22, 2024 · 123.00% of 5 mg label claim · Batch TBHO23 View
$27.00 $45.00
You will save $18.00
Lab Tested
Domestic & International
-40% OFF
Selank
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Selank Tuftsin-derived peptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide
Peptide Type Heptapeptide Thr-Lys-Pro-Arg-Pro-Gly-Pro
Human Half-Life Not established
Research Focus Neuroregulation Anxiolytic & nootropic research
Latest laboratory result 9.74 mg November 20, 2023 · 97.40% of 10 mg label claim · Batch HDSLK923 View
$27.00 $45.00
You will save $18.00
Lab Tested
Domestic & International
-40% OFF
Melanotan 2 10 mg
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Melanotan II MT-II
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Melanocortin peptide
Peptide Type Cyclic heptapeptide Synthetic α-MSH analog
Human Half-Life Not established
Development Status Unapproved
Latest laboratory result 10.06 mg April 18, 2025 · 100.60% of 10 mg label claim · Batch HDMLT923 View
$27.00 $45.00
You will save $18.00
Lab Tested
Domestic & International
-40% OFF
Semax
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance Semax ACTH(4–7)-PGP
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Regulatory peptide ACTH-derived peptide
Peptide Type Heptapeptide Met-Glu-His-Phe-Pro-Gly-Pro
Peptide Half-Life Several minutes
Research Focus Neuroregulation Nootropic & neuroprotective research
Latest laboratory result 5.20 mg November 20, 2023 · 104.00% of 5 mg label claim · Batch HDSX923 View
$39.00 $65.00
You will save $26.00
Coming Soon!
GHK-Cu 10 mg
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance GHK-Cu Copper tripeptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Copper-binding peptide
Peptide Type Tripeptide Gly-His-Lys · GHK
Human Half-Life Not established
Research Focus Tissue remodeling
$55.00
Out of stock
Shipped USA Domestic
-40% OFF
AOD 9604 5 mg
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance AOD9604 Modified hGH fragment
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class GH-derived peptide
Peptide Fragment hGH 176–191
Human Half-Life Not established
Development Status Investigational
$72.00 $120.00
You will save $48.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: