Dragon Pharma VIP 6 mg – Synthetic Vasoactive Intestinal Peptide for Research
✔ Synthetic 28-amino-acid neuropeptide ✔ Potent vasodilator and neurotransmitter ✔ Immune system regulator ✔ USA domestic shipping available
Dragon Pharma VIP 6 mg is a synthetic form of Vasoactive Intestinal Peptide (VIP), a 28-amino-acid human neuropeptide hormone that functions as a potent vasodilator, neurotransmitter, and immune system regulator. Produced naturally in the gastrointestinal tract, pancreas, and brain, VIP plays critical roles in smooth muscle relaxation, fluid and electrolyte secretion, and the modulation of inflammatory responses.
Each vial contains 6 mg of lyophilized VIP in a 2 mL format, requiring reconstitution with bacteriostatic water before use. This peptide has been extensively studied for its diverse biological activities, including vasodilation, neuroprotection, immunomodulation, and regulation of digestive and respiratory functions. For related research compounds, explore our peptides category and specifically Semax for complementary neuropeptide research applications.
What Makes VIP Valuable in Research?
VIP is a pleiotropic neuropeptide with a wide range of biological effects. Its ability to act as a potent vasodilator, relax smooth muscle, and modulate immune responses makes it a valuable research tool for investigating multiple physiological systems. VIP interacts with specific receptors (VPAC1 and VPAC2) that are widely distributed throughout the body, enabling its diverse functions.
Researchers value VIP for its versatility and its role in connecting nervous, endocrine, and immune systems. Its involvement in conditions ranging from inflammation and autoimmune disorders to gastrointestinal and respiratory function makes it relevant to numerous research areas. For investigators exploring immune-modulating peptides, Thymosin Alpha-1 offers complementary research avenues in immune system regulation.
Current scientific literature on VIP can be accessed through the PubMed database, where researchers can review peer-reviewed studies on its biological activity and experimental applications.
Key Research Applications for Dragon Pharma VIP
- ✔ Investigation of vasodilation and vascular regulation
- ✔ Evaluation of smooth muscle relaxation mechanisms
- ✔ Research on immune system modulation and inflammation
- ✔ Studies of gastrointestinal and respiratory physiology
- ✔ Preclinical models of neuroprotection and neural function
For Research Purposes Only
VIP 6 mg is intended for research use only and is not approved for human consumption. Proper handling, reconstitution, and experimental protocols are essential for reliable results. For studies on gastrointestinal function, BPC 157 provides additional research avenues in digestive tissue protection.
Technical Details
Peptide Type
Endogenous Neuropeptide
Peptide Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Peptide Length
28 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NH₂)
Molecular Formula
C₁₄₇H₂₃₇N₄₃O₄₃S
Molecular Weight
3325.8 g/mol
Primary Receptors
VPAC1 + VPAC2
Receptor Activity
VPAC1 / VPAC2 Agonist
Peptide Family
Secretin / Glucagon Peptide Family
Dosage & Usage Guidelines
For research and laboratory use only. Dragon Pharma VIP 6 mg is a synthetic human neuropeptide. Proper reconstitution, handling, and experimental design are essential for obtaining reliable data.
Reconstitution Protocol
- ✔ Use sterile bacteriostatic water for injection
- ✔ Add appropriate volume to achieve desired concentration
- ✔ Swirl gently to dissolve – do not shake vigorously
- ✔ Store reconstituted solution at 2–8°C
Reconstitute the lyophilized powder using bacteriostatic water to a concentration suitable for your research protocol. The 6 mg format allows for precise dosing across a range of experimental models. Always use aseptic technique during preparation to maintain peptide integrity.
Typical Research Parameters
In research settings, VIP is typically administered via subcutaneous, intravenous, or intraperitoneal injection. Dosing schedules and concentrations vary widely depending on the experimental design, animal model, and specific research objectives.
- ✔ Commonly used in vascular and smooth muscle studies
- ✔ Often combined with physiological and immunological analysis
- ✔ Used to investigate neuropeptide signaling pathways
- ✔ Research models include inflammation, digestion, and respiratory paradigms
Factors to Consider in Research Protocols
- Pleiotropic peptide with multiple receptor targets
- Reconstitution stability is limited; prepare fresh solutions for each use
- Individual variation in response may be observed across subjects
- Storage conditions significantly impact peptide stability
Research note: VIP is a 28-amino-acid neuropeptide with pleiotropic biological activities. Its potent vasodilatory, neurotransmitter, and immunomodulatory functions make it a versatile tool for investigating multiple physiological systems, including cardiovascular, gastrointestinal, respiratory, and immune function.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma VIP 6 mg used for?
VIP is used in research to investigate vasodilation, smooth muscle relaxation, immune regulation, and neuropeptide signaling. It is a 28-amino-acid human neuropeptide hormone with pleiotropic biological activities.
What is the function of Vasoactive Intestinal Peptide?
VIP functions as a potent vasodilator, neurotransmitter, and immune system regulator. It is produced in the gastrointestinal tract, pancreas, and brain, and plays critical roles in smooth muscle relaxation, fluid and electrolyte secretion, and inflammation modulation.
How do I reconstitute VIP 6 mg powder?
Reconstitute the lyophilized powder with sterile bacteriostatic water for injection. Add the appropriate volume, swirl gently until fully dissolved, and avoid vigorous shaking to preserve peptide integrity.
What is the shelf life of VIP after reconstitution?
Reconstituted VIP should be stored at 2–8°C and used within 14 days. Discard any unused solution after this period to ensure stability and research accuracy.
Is Dragon Pharma VIP 6 mg lab-tested?
Third-party laboratory testing for VIP 6 mg is currently pending. Batch-specific COA data will be published once analytical testing is completed and verified.
No reviews found
Please log in to write Vip 6 mg review.
