Dragon Pharma LL-37 5 mg – Natural Human Antimicrobial Peptide for Immune Research
✔ Natural human cathelicidin-derived peptide ✔ 37-amino-acid antimicrobial peptide ✔ First-line immune defense mechanism ✔ USA domestic shipping available
Dragon Pharma LL-37 5 mg is a natural human antimicrobial peptide derived from the cathelicidin protein. Consisting of 37 amino acids, LL-37 serves as a critical component of the innate immune system, acting as a first-line defense against microbial pathogens and playing important roles in wound healing and inflammation regulation.
Each vial contains 5 mg of lyophilized LL-37 in a 2 mL format, requiring reconstitution with bacteriostatic water before use. This peptide has been extensively studied for its broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, as well as its immunomodulatory properties and ability to promote wound healing. For related research compounds, explore our peptides category and specifically BPC 157 for complementary tissue repair research applications.
What Makes LL-37 Valuable in Research?
LL-37 is one of the most well-characterized antimicrobial peptides in the human immune system. It demonstrates a unique dual function: direct antimicrobial activity through membrane disruption and immunomodulatory effects that influence host immune responses. Its ability to neutralize endotoxins, modulate inflammatory cytokine production, and promote epithelial cell migration makes it a valuable tool for studying innate immunity and tissue repair.
Researchers value LL-37 for its broad-spectrum activity and its role in connecting innate and adaptive immune responses. Its involvement in wound healing, angiogenesis, and chemotaxis makes it relevant to studies ranging from infectious disease to tissue regeneration. For investigators exploring other immune-modulating compounds, Thymosin Alpha-1 offers complementary research avenues in immune system regulation.
Current scientific literature on LL-37 can be accessed through the PubMed database, where researchers can review peer-reviewed studies on its biological activity and experimental applications.
Key Research Applications for Dragon Pharma LL-37
- ✔ Investigation of antimicrobial mechanisms against pathogens
- ✔ Evaluation of immunomodulatory and anti-inflammatory effects
- ✔ Research on wound healing and tissue regeneration
- ✔ Studies of innate immune system function and regulation
- ✔ Preclinical models of infection and inflammation
For Research Purposes Only
LL-37 5 mg is intended for research use only and is not approved for human consumption. Proper handling, reconstitution, and experimental protocols are essential for reliable results. For studies on wound healing, TB 500 provides additional research avenues in tissue repair and angiogenesis.
Technical Details
Peptide Type
Human Cathelicidin Host-Defense Peptide
Peptide Sequence
[LL-37, 37 aa]
Peptide Length
37 Amino-Acid Residues
Terminal Form
H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH
Molecular Formula
C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight
4493 g/mol
Peptide Family
Cathelicidin Antimicrobial Peptide
Structural Profile
Cationic Amphipathic Peptide
Dosage & Usage Guidelines
For research and laboratory use only. Dragon Pharma LL-37 5 mg is a natural human antimicrobial peptide. Proper reconstitution, handling, and experimental design are essential for obtaining reliable data.
Reconstitution Protocol
- ✔ Use sterile bacteriostatic water for injection
- ✔ Add appropriate volume to achieve desired concentration
- ✔ Swirl gently to dissolve – do not shake vigorously
- ✔ Store reconstituted solution at 2–8°C
Reconstitute the lyophilized powder using bacteriostatic water to a concentration suitable for your research protocol. The 5 mg format allows for precise dosing across a range of experimental models. Always use aseptic technique during preparation to maintain peptide integrity.
Typical Research Parameters
In research settings, LL-37 is typically administered via subcutaneous or topical application. Dosing schedules and concentrations vary widely depending on the experimental design, animal model, and specific research objectives.
- ✔ Commonly used in antimicrobial and immune response studies
- ✔ Often combined with microbiological and immunological analysis
- ✔ Used to investigate wound healing and tissue repair mechanisms
- ✔ Research models include infection, inflammation, and tissue injury paradigms
Factors to Consider in Research Protocols
- Natural human peptide with broad-spectrum activity
- Reconstitution stability is limited; prepare fresh solutions for each use
- Individual variation in response may be observed across subjects
- Storage conditions significantly impact peptide stability
Research note: LL-37 is the only known human cathelicidin-derived antimicrobial peptide. Its unique dual functionality as both a direct antimicrobial agent and an immunomodulatory peptide makes it a valuable tool for investigating innate immunity, host defense mechanisms, and the complex interplay between infection, inflammation, and tissue repair.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is Dragon Pharma LL-37 5 mg used for?
LL-37 is used in research to investigate antimicrobial activity, immune system modulation, and wound healing mechanisms. It is the only human cathelicidin-derived antimicrobial peptide, consisting of 37 amino acids.
What is the source of LL-37?
LL-37 is a natural human antimicrobial peptide derived from the cathelicidin protein. It is produced by various cell types, including epithelial cells and immune cells, as part of the innate immune response.
How do I reconstitute LL-37 5 mg powder?
Reconstitute the lyophilized powder with sterile bacteriostatic water for injection. Add the appropriate volume, swirl gently until fully dissolved, and avoid vigorous shaking to preserve peptide integrity.
What is the shelf life of LL-37 after reconstitution?
Reconstituted LL-37 should be stored at 2–8°C and used within 14 days. Discard any unused solution after this period to ensure stability and research accuracy.
Is Dragon Pharma LL-37 5 mg lab-tested?
Third-party laboratory testing for LL-37 5 mg is currently pending. Batch-specific COA data will be published once analytical testing is completed and verified.
No reviews found
Please log in to write LL-37 5 mg review.
