Peptides
Latest laboratory result 5.47 mg / 5.33 mg November 10, 2025 · Ipamorelin 109.40% · Tesamorelin 106.60% · Batch HDIT10 View
You will save $28.00
Ipamorelin 5 mg/Tesamorelin 5 mg
Product Details Dragon Pharma
Active Formula Per vial
Ipamorelin Growth hormone secretagogue
5 mgTesamorelin GHRH analog
5 mgTotal Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg total labeled content
Form Lyophilized powder
Research Class GH-axis peptide blend
Half-Life Profile Ingredient-dependent Ipamorelin ~2 h IV · Tesamorelin ~11 min SC
Peptide Profile Dual peptide GHS + GHRH analog
$42.00
$70.00
Shipping Location :
International
U.S. Domestic
The Ultimate Peptide Synergy: Dragon Pharma Ipamorelin & Tesamorelin Blend
Dragon Pharma presents a groundbreaking advancement in peptide therapy with its innovative Ipamorelin 5 mg/Tesamorelin 5 mg blend. This powerful 10 mg combination vial represents the pinnacle of growth hormone optimization, specifically formulated for bodybuilders, athletes, and fitness enthusiasts who demand superior results with an exceptional safety profile. By combining two of the most advanced and selective growth hormone secretagogues available, this blend offers a synergistic effect that is greater than the sum of its parts, targeting both overall anabolic enhancement and specific, stubborn fat reduction.
This unique blend leverages the distinct mechanisms of its two powerhouse components. Ipamorelin is a fifth-generation growth hormone-releasing peptide (GHRP) renowned for its purity of action. It stimulates the pituitary gland to release growth hormone without significantly affecting cortisol, prolactin, or ACTH levels. This results in a clean, targeted increase in GH. Tesamorelin, on the other hand, is a synthetic analog of growth hormone-releasing hormone (GHRH). It works by mimicking the body's natural GHRH, promoting a sustained and pulsatile release of growth hormone that closely resembles the body's natural rhythm. Research published by the National Center for Biotechnology Information (NCBI) highlights the efficacy of Tesamorelin in significantly reducing visceral adipose tissue, making it a uniquely powerful tool for fat loss. When combined, these peptides create a powerful signal for growth hormone release, leading to unparalleled results in body composition improvement.
Unmatched Benefits of the Ipamorelin/Tesamorelin Blend
- Superior Fat Loss, Especially Visceral Fat: Tesamorelin is clinically proven to target and reduce visceral fat—the dangerous fat stored around organs. This leads to a dramatic improvement in midsection definition and overall health markers.
- Lean Muscle Accretion Without Water Retention: Ipamorelin promotes clean, dry gains in lean muscle mass. Unlike some other peptides or compounds, this blend typically results in very low water retention, giving you a hard, vascular look. For those seeking even more defined muscle separation, this stack pairs excellently with a cutting agent like Winstrol (Stanozolol).
- Enhanced Skin Quality and Anti-Aging Effects: Increased collagen synthesis from elevated GH levels leads to improved skin elasticity, thickness, and a reduction in the appearance of wrinkles.
- Improved Bone Density and Joint Recovery: The anabolic effects extend to connective tissues, accelerating healing from injuries and strengthening bones, which is crucial for long-term athletic longevity.
- Minimal Side Effects and No Desensitization: Ipamorelin is known for not causing desensitization of the pituitary gland over time, allowing for longer, more effective cycles. The blend has a very low incidence of hunger, cortisol spikes, or other negative side effects common in earlier-generation peptides.
- Deep, Restorative Sleep: Users consistently report significantly improved sleep quality, which is essential for muscle recovery and natural hormone production. To further optimize sleep architecture during a demanding cycle, some users incorporate a supportive supplement like Melatonin.
Technical Details
Formula Type
Dual Peptide Blend
Research Pathways
Ghrelin Receptor + GHRH Receptor Signaling
Ipamorelin
Peptide Type
Synthetic Pentapeptide
Peptide Sequence
Aib-His-D-2-Nal-D-Phe-Lys-NH₂
Peptide Length
5 Residues
Molecular Formula
C₃₈H₄₉N₉O₅
Molecular Weight
711.9 g/mol
PubChem CID
9831659
Receptor Target
Ghrelin Receptor (GHSR)
Tesamorelin
Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
CAS Number
218949-48-5
PubChem CID
16137828
Receptor Target
GHRH Receptor (GHRHR)
Dosage & Usage Guidelines
Each vial of Dragon Pharma's blend contains a total of 10 mg (5 mg Ipamorelin + 5 mg Tesamorelin) of ultra-pure lyophilized powder. Reconstitution is a critical step that must be performed with care to preserve peptide integrity. Using bacteriostatic water and a sterile syringe, slowly inject 1-2 mL of water into the vial, directing the stream against the glass wall. Gently swirl or roll the vial until the powder is completely dissolved into a clear solution. Avoid shaking vigorously. Once reconstituted, the vial must be stored in a refrigerator (36°F-46°F) and used within 4-6 weeks.
The recommended dosage for this potent blend typically ranges from 100 mcg to 300 mcg (total volume, representing a proportional amount of each peptide) per injection. Due to its potency and longer half-life, many users find that 1-2 injections per day are sufficient. The most effective administration times are:
- Before Bed: This is the most critical dose, as it amplifies the body's largest natural GH pulse during deep sleep.
- Upon Waking: A morning dose can help counteract the catabolic state of an overnight fast.
Injections are best administered subcutaneously in adipose tissue (e.g., stomach fat) and should be done on an empty stomach. Allow at least 30-60 minutes after injection before consuming food and wait 2 hours after a meal to inject. This ensures that food-induced insulin spikes do not blunt the GH release. For athletes looking to build a comprehensive anabolic environment, this peptide blend can serve as a perfect base to support a cycle with a versatile compound like Deca 300 (Nandrolone Decanoate), known for its joint-supporting and mass-building properties.
Safety and Side Effect Profile: Why This Blend Stands Out
The Ipamorelin/Tesamorelin blend is celebrated for its outstanding safety profile. It represents a significant evolution from earlier peptides like GHRP-6. Key safety advantages include:
- No Increase in Appetite: Unlike GHRP-6, this blend does not stimulate hunger, making it ideal for cutting phases.
- No Impact on Cortisol or Prolactin: Ipamorelin is highly selective, avoiding unwanted hormonal fluctuations.
- No Aromatization or Hepatotoxicity: As peptides, they do not convert to estrogen and present zero risk of liver damage.
Potential side effects are generally mild and transient, such as minor tingling in the extremities or slight redness at the injection site. Due to its clean nature, a specific Post Cycle Therapy (PCT) is not required for the peptides themselves. However, if this blend is used as part of a larger stack including suppressive compounds, a standard PCT protocol with a SERM like Clomid (Clomiphene Citrate) is essential to restore natural testosterone production.
Dragon Pharma Quality: A Commitment to Excellence
When you choose Dragon Pharma, you are selecting a product born from precision engineering. This blend is manufactured in cGMP-certified facilities, with each batch undergoing rigorous third-party testing for purity (consistently over 99%), concentration, and sterility. This guarantees that you receive a product that delivers consistent, reliable, and potent results with every injection. For the advanced user aiming for a dramatic recomposition effect, stacking this peptide blend with a powerful yet dry anabolic such as Anavar (Oxandrolone) can yield spectacular fat loss and muscle hardening results.
In conclusion, the Dragon Pharma Ipamorelin 5 mg/Tesamorelin 5 mg blend is a premium, sophisticated tool for the modern athlete. It effectively harnesses the power of two distinct peptide pathways to promote significant improvements in muscle quality, fat loss, and overall recovery, all while maintaining an unparalleled safety profile. Whether you are preparing for a competition or simply striving to achieve your personal best, this blend provides a clear path to a superior physique.
Lab Testing & Batch Transparency
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Dragon Pharma distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Dragon Pharma presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
Why is this blend better than using Ipamorelin or Tesamorelin alone?
This blend creates a powerful synergistic effect. Ipamorelin (a GHRP) and Tesamorelin (a GHRH analog) work on different receptors in the hypothalamic-pituitary axis. Using them together mimics the body's natural GH release process more completely than either could alone. The result is a significantly greater and more sustained release of Growth Hormone, leading to enhanced fat loss (particularly from the abdomen via Tesamorelin) and muscle growth (via Ipamorelin's clean anabolic signal) with superior efficiency.
Is this blend suitable for reducing belly fat specifically?
Yes, this is one of the primary advantages of the Tesamorelin component. Clinical studies have specifically demonstrated Tesamorelin's efficacy in reducing visceral adipose tissue (VAT)—the deep, hard-to-lose fat in the abdominal cavity. When combined with Ipamorelin's overall body composition benefits, this blend is arguably the most effective peptide protocol available for targeted abdominal fat reduction and achieving a leaner midsection.
How long until I see visible results from this peptide blend?
Results are progressive. Most users report improved sleep quality and a slight increase in recovery rate within the first 2-3 weeks. Visible changes in body composition, such as reduced abdominal fat and improved muscle definition, typically become noticeable after 6-8 weeks of consistent use. For optimal, transformative results, a cycle of 12-16 weeks is recommended. The cumulative effect over time is where the most dramatic changes occur.
Do I need to cycle this blend, and is PCT required?
While peptides do not suppress the HPTA axis like anabolic steroids, cycling is still recommended for long-term effectiveness and to allow receptor sensitivity to reset. A common protocol is 12-16 weeks on, followed by a 4-8 week break. A traditional PCT is not necessary for the peptides themselves. However, if you are stacking this blend with suppressive anabolic compounds, a full PCT is absolutely required to restore natural testosterone production.
Related Offers
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance MOTS-c Mitochondrial-derived peptide
Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg labeled content
Form Lyophilized powder
Research Class Mitochondrial peptide
Peptide Type 16-amino-acid peptide Mitochondrial 12S rRNA encoded
Human Half-Life Not established
Research Focus Metabolic signaling AMPK-associated pathways
$42.00
$70.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance BPC-157 Synthetic pentadecapeptide
Strength 5 mg per vial
Package 1 × 2 mL vial 5 mg labeled content
Form Lyophilized powder
Research Class Research peptide
Peptide Type Pentadecapeptide 15 amino acids
Human Half-Life Not established
Development Status Investigational
$24.00
$40.00
Lab Tested
Shipped International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Formula Per vial
TB-500 Thymosin β4-derived peptide
5 mgBPC-157 Synthetic pentadecapeptide
5 mgTotal Strength 10 mg per vial
Package 1 × 2 mL vial 10 mg total labeled content
Form Lyophilized powder
Research Class Peptide blend
Peptide Profile Dual peptide TB-500 + BPC-157
Human Half-Life Not established
$48.00
$80.00
Lab Tested
Domestic & International
-40% OFF
Dragon Pharma, Europe
Product Details Dragon Pharma
Active Substance GHK-Cu Copper tripeptide
Strength 50 mg per vial
Package 1 × 2 mL vial 50 mg labeled content
Form Lyophilized powder
Research Class Copper-binding peptide
Peptide Type Tripeptide Gly-His-Lys · GHK
Human Half-Life Not established
Research Focus Tissue remodeling
$27.00
$45.00