Vip 6 mg
Peptide Hubs

Vip 6 mg

Product Details Peptide Hubs
Active Substance Vasoactive Intestinal Peptide VIP
Strength 6 mg per vial
Package 1 × 2 mL vial 6 mg labeled content
Form Lyophilized powder
Peptide Class Neuropeptide hormone Secretin / glucagon peptide family
Peptide Length 28 amino acids Linear regulatory peptide
Primary Targets VPAC1 & VPAC2 receptors Class B G protein-coupled receptors
Research Areas GI, vascular & neural signaling Smooth-muscle, secretion and neuroendocrine research
Out of stock

VIP 6 mg – Vasoactive Intestinal Peptide for Inflammation & Neuroimmune Research

VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide naturally produced in the gut, brain, and immune tissues. It is involved in a wide range of physiological processes, including smooth muscle relaxation, immune modulation, gastrointestinal function, and circadian rhythm regulation. This 6 mg (2 mL) vial by Peptide Hubs is a high-purity peptide formulation intended for research use only.

What Is Vasoactive Intestinal Peptide (VIP)?

VIP is a pleiotropic signaling molecule with potent anti-inflammatory and immunomodulatory properties. It plays a critical role in regulating the enteric nervous system, pulmonary function, cardiovascular tone, and neuroprotection. According to published data on PubMed, VIP has been shown to suppress pro-inflammatory cytokines while enhancing regulatory T-cell activity, making it an attractive compound for inflammatory and autoimmune research.

Key Research Applications

  • Gut-brain axis signaling and motility regulation
  • Anti-inflammatory and immunomodulatory models
  • Research into pulmonary hypertension and asthma
  • Neuroprotective peptide in CNS and neurodegenerative models
  • Autoimmune disease and systemic inflammation studies

Technical Details

Peptide Type
Endogenous Neuropeptide
Peptide Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NHβ‚‚
Peptide Length
28 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NHβ‚‚)
Molecular Formula
C₁₄₇H₂₃₇N₄₃O₄₃S
Molecular Weight
3325.8 g/mol
CAS Number
40077-57-4
PubChem CID
16132369
Primary Receptors
VPAC1 + VPAC2
Receptor Activity
VPAC1 / VPAC2 Agonist
Peptide Family
Secretin / Glucagon Peptide Family

Dosage & Usage Guidelines

Typical preclinical studies use VIP at 2–6 mg per week, divided into subcutaneous or intravenous injections. Due to its short half-life in vivo, some research protocols utilize stabilized formulations or frequent dosing. VIP is not bioavailable orally and should be handled with sterile technique under lab-controlled conditions.

Synergistic Peptides for Research Stacking

Researchers commonly combine VIP with other anti-inflammatory or neuroactive peptides for synergistic benefit:

  • BPC-157 – for GI tract healing and gut-brain axis studies
  • Selank – supports neuroimmune balance and stress regulation
  • GHK-Cu – for regenerative and anti-inflammatory synergy
  • SS-31 – mitochondrial protection and oxidative stress modulation
  • Thymalin – systemic immune normalization in aging and chronic disease models

Safety Profile

VIP has demonstrated a favorable safety profile in early human trials and preclinical models. It does not affect sex hormones or metabolic functions and shows no evidence of toxicity to liver, kidney, or cardiovascular systems. Because of its short half-life, dosing protocols may require precision timing or peptide stabilization methods.

USA Domestic Shipping & Quality Control

Peptide Hubs provides fast and discreet USA domestic shipping for VIP 6 mg and all peptide research products. Every vial is manufactured in GMP-compliant labs and batch-tested for purity and sterility. VIP is a high-value research tool for gastrointestinal, neurological, and immune applications.

Shipping & Product Authenticity

USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery

This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.

What to Expect

  • βœ” Orders are processed after payment confirmation
  • βœ” USA Domestic shipping is typically faster when local stock is selected
  • βœ” International orders include tracking, though update frequency may vary by destination
  • βœ” Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply

For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.

Storage

Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.

After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.

Keep out of reach of children. Follow proper handling and sterile injection practices during research use.

Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.

Frequently Asked Questions

What is VIP used for in research?

VIP is used in research focused on neuroimmune signaling, inflammation control, pulmonary health, and gastrointestinal motility.

Is VIP a hormone or a neurotransmitter?

VIP acts as both a neurotransmitter and hormone-like peptide, involved in smooth muscle relaxation, immune signaling, and circadian rhythm regulation.

Can VIP be stacked with other research peptides?

Yes, VIP is often stacked with BPC-157, Selank, or SS-31 for advanced gut-brain axis, anti-inflammatory, and neuroprotective research.

Is VIP safe in preclinical models?

VIP has shown good tolerability in early-phase research with no known toxicity in preclinical models. It is research-use only and not approved for therapeutic use.

No reviews found

Please log in to write Vip 6 mg review.

Related Offers
Lab Tested
Domestic & International
-40% OFF
Ipamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Ipamorelin
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GH secretagogue
Peptide Length 5 amino acids Pentapeptide
Terminal Half-Life ~2 hours
Primary Target GHS-R Ghrelin receptor pathway
Latest laboratory result 4.65 mg/vial January 12, 2026 · 93.00% of 5 mg label claim · Batch #GAIPA12 View
$26.40 $44.00
You will save $17.60
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Thymosin Beta-4 Tβ4
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class β-Thymosin peptide
Peptide Length 43 amino acids
Human Half-Life Not established
Primary Target G-actin Actin sequestration
Latest laboratory result 5.16 mg/vial October 1, 2025 · 103.20% of 5 mg label claim · Batch #TB500GA8 View
$24.00 $40.00
You will save $16.00
Lab Tested
Domestic & International
-40% OFF
TB 500 5 mg/BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mg
BPC-157Synthetic pentadecapeptide
5 mg
Total Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
Latest laboratory result 5.85 mg / 5.97 mg January 1, 2026 · 117.00% / 119.40% of label claim · Batch #GATBBPC12 View
$45.00 $75.00
You will save $30.00
Lab Tested
Domestic & International
-40% OFF
BPC 157 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
Latest laboratory result 5.17 mg/vial October 1, 2025 · 103.40% of 5 mg label claim · Batch #BPCGA8 View
$22.80 $38.00
You will save $15.20
Lab Tested
Domestic & International
-40% OFF
Melanotan 2 10 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Melanotan II MT-II
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Melanocortin analogue Synthetic cyclic peptide
Peptide Length 7 amino acids Cyclic heptapeptide
Human Half-Life Not established
Primary Targets Melanocortin receptors Nonselective agonist
Latest laboratory result 10.45 mg/vial April 22, 2025 · 104.50% of 10 mg label claim View
$26.40 $44.00
You will save $17.60
Coming Soon!
Tesamorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Tesamorelin GHRH / GRF analogue
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Drug Class GHRH analogue
Peptide Length 44 amino acids
SC Half-Life ~8–11 minutes Formulation dependent
Primary Target GHRH receptor Pituitary GH axis
Out of stock
Lab Tested
Shipped International
-40% OFF
Sermorelin 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Sermorelin GHRH(1–29)-NH2
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GHRH analogue
Peptide Length 29 amino acids
Half-Life ~11–12 minutes
Primary Target GHRH receptor Pituitary GH axis
Latest laboratory result 5.12 mg/vial January 12, 2026 · 102.40% of 5 mg label claim · Batch #GASER12 View
$24.00 $40.00
You will save $16.00
Lab Tested
Shipped International
-40% OFF
Semax 5 mg
Peptide Hubs
Product Details Peptide Hubs
Active Substance Semax ACTH(4–7)-Pro-Gly-Pro
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Neuropeptide ACTH-derived analogue
Peptide Length 7 amino acids MEHFPGP
Human Half-Life Not established
Research Focus Neuroprotection & cognition
Latest laboratory result 11.27 mg/vial January 12, 2026 · 225.40% of 5 mg label claim · Batch #GASEMA12 View
$42.00 $70.00
You will save $28.00

Add to Cart - Product(s)

Close Button
Empty

Total Cost: