VIP 6 mg – Vasoactive Intestinal Peptide for Inflammation & Neuroimmune Research
VIP (Vasoactive Intestinal Peptide) is a 28-amino acid neuropeptide naturally produced in the gut, brain, and immune tissues. It is involved in a wide range of physiological processes, including smooth muscle relaxation, immune modulation, gastrointestinal function, and circadian rhythm regulation. This 6 mg (2 mL) vial by Peptide Hubs is a high-purity peptide formulation intended for research use only.
What Is Vasoactive Intestinal Peptide (VIP)?
VIP is a pleiotropic signaling molecule with potent anti-inflammatory and immunomodulatory properties. It plays a critical role in regulating the enteric nervous system, pulmonary function, cardiovascular tone, and neuroprotection. According to published data on PubMed, VIP has been shown to suppress pro-inflammatory cytokines while enhancing regulatory T-cell activity, making it an attractive compound for inflammatory and autoimmune research.
Key Research Applications
- Gut-brain axis signaling and motility regulation
- Anti-inflammatory and immunomodulatory models
- Research into pulmonary hypertension and asthma
- Neuroprotective peptide in CNS and neurodegenerative models
- Autoimmune disease and systemic inflammation studies
Technical Details
Peptide Type
Endogenous Neuropeptide
Peptide Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NHβ
Peptide Length
28 Amino-Acid Residues
Terminal Form
C-Terminal Amide (-NHβ)
Molecular Formula
CβββHβββNββOββS
Molecular Weight
3325.8 g/mol
Primary Receptors
VPAC1 + VPAC2
Receptor Activity
VPAC1 / VPAC2 Agonist
Peptide Family
Secretin / Glucagon Peptide Family
Dosage & Usage Guidelines
Typical preclinical studies use VIP at 2–6 mg per week, divided into subcutaneous or intravenous injections. Due to its short half-life in vivo, some research protocols utilize stabilized formulations or frequent dosing. VIP is not bioavailable orally and should be handled with sterile technique under lab-controlled conditions.
Synergistic Peptides for Research Stacking
Researchers commonly combine VIP with other anti-inflammatory or neuroactive peptides for synergistic benefit:
- BPC-157 – for GI tract healing and gut-brain axis studies
- Selank – supports neuroimmune balance and stress regulation
- GHK-Cu – for regenerative and anti-inflammatory synergy
- SS-31 – mitochondrial protection and oxidative stress modulation
- Thymalin – systemic immune normalization in aging and chronic disease models
Safety Profile
VIP has demonstrated a favorable safety profile in early human trials and preclinical models. It does not affect sex hormones or metabolic functions and shows no evidence of toxicity to liver, kidney, or cardiovascular systems. Because of its short half-life, dosing protocols may require precision timing or peptide stabilization methods.
USA Domestic Shipping & Quality Control
Peptide Hubs provides fast and discreet USA domestic shipping for VIP 6 mg and all peptide research products. Every vial is manufactured in GMP-compliant labs and batch-tested for purity and sterility. VIP is a high-value research tool for gastrointestinal, neurological, and immune applications.
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- β Orders are processed after payment confirmation
- β USA Domestic shipping is typically faster when local stock is selected
- β International orders include tracking, though update frequency may vary by destination
- β Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
What is VIP used for in research?
VIP is used in research focused on neuroimmune signaling, inflammation control, pulmonary health, and gastrointestinal motility.
Is VIP a hormone or a neurotransmitter?
VIP acts as both a neurotransmitter and hormone-like peptide, involved in smooth muscle relaxation, immune signaling, and circadian rhythm regulation.
Can VIP be stacked with other research peptides?
Yes, VIP is often stacked with BPC-157, Selank, or SS-31 for advanced gut-brain axis, anti-inflammatory, and neuroprotective research.
Is VIP safe in preclinical models?
VIP has shown good tolerability in early-phase research with no known toxicity in preclinical models. It is research-use only and not approved for therapeutic use.
No reviews found
Please log in to write Vip 6 mg review.