Peptide Hubs
Latest laboratory result 5.14 mg / 4.24 mg January 12, 2026 · 102.80% / 84.80% of label claim · Batch #GATESIPA12 View
You will save $28.00
Tesamorelin 5 mg/Ipamorelin 5 mg
Product Details Peptide Hubs
Active Formula Per vial
TesamorelinGHRH analogue
5 mgIpamorelinGH secretagogue
5 mgTotal Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class GH-axis peptide blend
Primary Targets GHRH-R / GHS-R
Half-Life Profile Component-specific Tesamorelin ~8–11 min · Ipamorelin ~2 h
$42.00
$70.00
Shipping Location :
International
U.S. Domestic
Premium Tesamorelin/Ipamorelin 10mg Blend by Peptide Hubs
Experience the synergistic power of two exceptional growth hormone secretagogues with Peptide Hubs' Tesamorelin/Ipamorelin 10mg blend. This premium combination features 5mg of Tesamorelin and 5mg of Ipamorelin, meticulously formulated to maximize growth hormone release while minimizing unwanted side effects. Sourced from Dragon Pharma's trusted manufacturing facilities, this pharmaceutical-grade peptide complex represents the cutting edge of performance enhancement and body composition optimization.
Scientific Superiority of Combined Peptide Therapy
The strategic combination of Tesamorelin and Ipamorelin creates a powerful synergistic effect that surpasses what either peptide could achieve individually. Tesamorelin, a synthetic analog of growth hormone-releasing hormone (GHRH), stimulates the pituitary gland to produce and release growth hormone. Meanwhile, Ipamorelin, a selective growth hormone secretagogue (GHS), works through the ghrelin receptor pathway to amplify this effect. Together, they create a robust pulsatile GH release that closely mimics the body's natural secretion patterns.
According to research published in the Oxford Academic, combination therapy with GHRH and GHS peptides can produce a synergistic growth hormone response that is significantly greater than the sum of individual responses. This scientific foundation makes the Tesamorelin/Ipamorelin blend exceptionally effective for athletes seeking optimal body composition changes.
Benefits for Serious Athletes
The Tesamorelin/Ipamorelin blend offers multiple performance-enhancing benefits that make it particularly valuable for bodybuilders, athletes, and fitness enthusiasts:
- Enhanced Fat Loss: Specifically targets visceral and abdominal fat deposits, creating dramatic improvements in muscle definition.
- Improved Recovery: Accelerates recovery between workouts by promoting protein synthesis and cellular repair.
- Increased Lean Mass: Supports the development of quality muscle tissue without water retention.
- Superior Sleep Quality: Enhances deep sleep phases when administered before bedtime, maximizing natural GH pulses.
- Joint and Ligament Support: Promotes collagen synthesis, strengthening connective tissues and reducing injury risk.
For those seeking alternative growth hormone support, consider our GHRP-6 which offers powerful hunger-stimulating effects alongside GH release.
Technical Details
Formula Type
Dual Peptide Blend
Research Pathways
Ghrelin Receptor + GHRH Receptor Signaling
Ipamorelin
Peptide Type
Synthetic Pentapeptide
Peptide Sequence
Aib-His-D-2-Nal-D-Phe-Lys-NH₂
Peptide Length
5 Residues
Molecular Formula
C₃₈H₄₉N₉O₅
Molecular Weight
711.9 g/mol
PubChem CID
9831659
Receptor Target
Ghrelin Receptor (GHSR)
Tesamorelin
Peptide Type
Stabilized GHRH Analogue
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Peptide Length
44 Amino-Acid Residues
Structural Modification
N-Terminal trans-3-Hexenoyl Group
Molecular Formula
C₂₂₁H₃₆₆N₇₂O₆₇S
Molecular Weight
5136 g/mol
CAS Number
218949-48-5
PubChem CID
16137828
Receptor Target
GHRH Receptor (GHRHR)
Dosage & Usage Guidelines
Reconstitute the lyophilized powder with bacteriostatic water before administration. The typical dosage ranges from 100-300 mcg of the combined blend, administered 1-2 times daily. Most users experience optimal results with pre-bedtime administration to coincide with the body's natural nocturnal growth hormone surge. Some athletes benefit from an additional dose upon waking in a fasted state.
For precise dosing, consider pairing with our Bacteriostatic Water which is specifically formulated for peptide reconstitution.
Cycle Information and Stacking Options
Typical cycles range from 8-12 weeks, followed by a 4-week break to prevent desensitization. Many users report noticeable changes in body composition within the first 4-6 weeks, with continued improvements throughout the cycle. For enhanced results, the Tesamorelin/Ipamorelin blend can be stacked with other peptides that complement its action.
Consider combining with CJC-1295 for extended growth hormone release, or with BPC-157 for accelerated injury recovery and enhanced joint support.
Why Choose Peptide Hubs' Tesamorelin/Ipamorelin Blend?
Our Tesamorelin/Ipamorelin combination undergoes rigorous third-party testing to ensure purity, potency, and sterility. Each batch is manufactured in ISO-certified facilities using pharmaceutical-grade ingredients and advanced lyophilization technology. The result is a premium peptide product that delivers consistent, measurable results for serious athletes.
For those interested in other peptide options, explore our Melanotan II for tanning and metabolic benefits, or our PT-141 for performance enhancement of a different nature.
Peptide Hubs remains committed to providing the highest quality research peptides to the athletic community. Our Tesamorelin/Ipamorelin blend represents the pinnacle of peptide technology, offering a safe, effective alternative to traditional growth hormone therapy without the associated risks or prohibitive costs.
Batch-Tested & Verified Lab Results
Shipping & Product Authenticity
USA Domestic
4–5 business days
International
13–15 business days
Order Processing
24–48 business hours
Tracking
Tracking number provided
Direct Supply & Discreet Delivery
This product is supplied through the official Peptide Hubs distribution chain and shipped in original manufacturer packaging. The outer shipping package remains discreet, with privacy-focused handling and no unnecessary external product details.
What to Expect
- ✔ Orders are processed after payment confirmation
- ✔ USA Domestic shipping is typically faster when local stock is selected
- ✔ International orders include tracking, though update frequency may vary by destination
- ✔ Multiple warehouses may result in separate shipments when applicable
Authenticity support: official Peptide Hubs presentation, batch-linked lab proof, and original packaging help reinforce product legitimacy and buyer confidence.
Verified Supply
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Storage
Store the lyophilized powder at controlled room temperature (15–25°C) in a dry, dark place, away from direct light and moisture. The unopened vial should be kept in its original packaging to maintain stability.
After reconstitution, store the solution at 2–8°C and use within 14 days. Do not freeze. Discard any unused portion after the recommended storage period. Before use, inspect the solution and avoid use if it appears cloudy, discolored, or contains particulate matter, or if the vial or seal is compromised.
Keep out of reach of children. Follow proper handling and sterile injection practices during research use.
Proper storage conditions help maintain product stability and consistent performance across the product's shelf life.
Frequently Asked Questions
How should I reconstitute Tesamorelin/Ipamorelin blend?
Reconstitute with 1-2 mL of bacteriostatic water. Gently swirl the vial until the powder is fully dissolved—do not shake vigorously as this may damage the peptide structure. Once reconstituted, store in the refrigerator and use within 4-6 weeks for optimal potency.
When is the best time to administer this peptide blend?
The most effective administration time is before bedtime to coincide with your body's natural growth hormone pulse. Many users also benefit from a second dose upon waking in a fasted state. Avoid administering immediately after meals as elevated blood glucose can blunt the growth hormone response.
What results can I expect from using Tesamorelin/Ipamorelin?
Users typically notice improved sleep quality and enhanced recovery within the first week. Visible fat loss, especially around the abdominal area, becomes apparent within 4-6 weeks. Full cycle results include significantly improved muscle definition, reduced body fat, enhanced recovery, and improved skin texture.
Are there any side effects associated with this peptide blend?
Tesamorelin/Ipamorelin is generally well-tolerated. Some users report temporary flushing, lightheadedness, or tingling sensations shortly after injection—these typically subside within 30 minutes. Unlike traditional GH therapy, this blend does not cause water retention, joint pain, or carpal tunnel syndrome.
How does this blend compare to traditional growth hormone therapy?
Unlike synthetic growth hormone which creates unphysiological hormone levels, Tesamorelin/Ipamorelin stimulates your body's natural production and pulsatile release pattern. This results in similar benefits with fewer side effects, no suppression of natural GH production, and a significantly lower cost.
Related Offers
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Formula Per vial
Thymosin Beta-4β-Thymosin peptide
5 mgBPC-157Synthetic pentadecapeptide
5 mgTotal Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Multi-peptide blend
Research Focus Tissue repair Regenerative research
Human PK Not established For combined formulation
$45.00
$75.00
Lab Tested
Domestic & International
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance BPC-157 Body Protection Compound 157
Strength 5 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Synthetic peptide
Peptide Length 15 amino acids Pentadecapeptide
Human Half-Life Not established
Development Status Investigational
$22.80
$38.00
Lab Tested
Domestic & International
NEW
-40% OFF
Peptide Hubs
Product Details Peptide Hubs
Active Substance MOTS-c Mitochondrial-derived peptide
Strength 10 mg/vial
Vial Size 2 mL vial
Form Lyophilized powder For reconstitution
Research Class Mitochondrial peptide
Peptide Length 16 amino acids
Human Half-Life Not established
Research Pathway AMPK signaling Metabolic research
$40.80
$68.00